StarFunc result for job id Q9C0G0

User Input

>input (2248 residues)
MMDSENKPENDEDEKINKEAQDLTKLSSHNEDGGPVSDVIASFPENSMGKRGFSESSNSD
SVVIGEDRNKHASKRRKLDEAEPLKSGKQGICRLETSESSVTEGGIALDETGKETFLSDC
TVGGTCLPNALSPSCNFSTIDVVSLKTDTEKTSAQEMVSLDLERESPFPPKEISVSCTIG
NVDTVLKCSICGHLFSSCSDLEKHAESHMQQPKEHTCCHCSHKAESSSALHMHIKQAHGP
QKVFSCDLCGFQCSEENLLNAHYLGKTHLRRQNLAARGGFVQILTKQPFPKKSRTMATKN
VHSKPRTSKSIAKNSDSKGLRNVGSTFKDFRGSISKQSGSSSELLVEMMPSRNTLSQEVE
IVEEHVTSLGLAQNPENQSRKLDTLVTSEGLLEKLESTKNTLQAAHGNSVTSRPRPERNI
LVLGNSFRRRSSTFTLKGQAKKRFNLLGIKRGTSETQRMYMKHLRTQMKTHDAESVLKHL
EACSSVQRVCVTTSETQEAEQGQGSARPPDSGLHSLTVKPASGSQTLCACTDCGQVATNR
TDLEIHVKRCHAREMKFYCRTCDFSSMSRRDLDEHLHSNQHQQTASVLSCQCCSFISLDE
INLRDHMKEKHNMHFLCTPCNLFFLSEKDVEEHKATEKHINSLVQPKTLQSSNSDLVLQT
LPLSTLESENAKESMDDSGKASQEEPLKSRVSHGNEVRHSSKPQFQCKKCFYKTRSSTVL
TRHIKLRHGQDYHFLCKACNLYSLSKEGMEKHIKRSKHLENAKKNNIGLSFEECIERVCI
GANDKKEEFDVSGNGRIEGHIGVQLQEHSYLEKGMLASEELSQSGGSTKDDELASTTTPK
RGRPKGNISRTCSHCGLLASSITNLTVHIRRKHSHQYSYLCKVCKYYTVTKGDMERHCAT
KKHKGRVEIEASGKHSSDIIVGPEGGSLEAGKKNAGSAVTMSDEHANKPAESPTSVLEKP
DRGNSIEAEVENVFHSLDGEVNSHLLDKKEQISSEPEDFAQPGDVYSQRDVTGTGENKCL
HCEFSAHSSASLELHVKRKHTKEFEFYCMACDYYAVTRREMTRHAATEKHKMKRQSYLNS
ANVEAGSADMSKNIIMPEEEHQQNSEEFQIISGQPSDTLKSRNAADCSILNENTNLDMSK
VLCAADSVEVETEEESNFNEDHSFCETFQQAPVKDKVRKPEEMMSLTMSSNYGSPSRFQN
ENSGSSALNCETAKKNHEISNDAGELRVHCEGEGGNAGDGGGVVPHRHLCPVTLDGERSA
ESPVLVVTRITREQGNLESGGQNRVARGHGLEDLKGVQEDPVLGNKEILMNSQHETEFIL
EEDGPASDSTVESSDVYETIISIDDKGQAMYSFGRFDSSIIRIKNPEDGELIDQSEEGLI
ATGVRISELPLKDCAQGVKKKKSEGSSIGESTRIRCDDCGFLADGLSGLNVHIAMKHPTK
EKHFHCLLCGKSFYTESNLHQHLASAGHMRNEQASVEELPEGGATFKCVKCTEPFDSEQN
LFLHIKGQHEELLREVNKYIVEDTEQINREREENQGNVCKYCGKMCRSSNSMAFLAHIRT
HTGSKPFKCKICHFATAQLGDARNHVKRHLGMREYKCHVCGVAFVMKKHLNTHLLGKHGV
GTPKERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKCTWPTCHYSFLTASAMKDHYRTH
TGEKSFLCDLCGFAGGTRHALTKHRRQHTGEKPFKCDECNFASTTQSHLTRHKRVHTGEK
PYRCPWCDYRSNCAENIRKHILHTGKHEGVKMYNCPKCDYGTNVPVEFRNHLKEQHPDIE
NPDLAYLHAGIVSKSYECRLKGQGATFVETDSPFTAAALAEEPLVKEKPLRSSRRPAPPP
EQVQQVIIFQGYDGEFALDPSVEETAAATLQTLAMAGQVARVVHITEDGQVIATSQSGAH
VGSVVPGPILPEQLADGATQVVVVGGSMEGHGMDESLSPGGAVIQQVTKQEILNLSEAGV
APPEASSALDALLCAVTELGEVEGRAGLEEQGRPGAKDVLIQLPGQEVSHVAADPEAPEI
QMFPQAQESPAAVEVLTQVVHPSAAMASQERAQVAFKKMVQGVLQFAVCDTAAAGQLVKD
GVTQVVVSEEGAVHMVAGEGAQIIMQEAQGEHMDLVESDGEISQIIVTEELVQAMVQESS
GGFSEGTTHYILTELPPGVQDEPGLYSHTVLETADSQELLQAGATLGTEAGAPSRAEQLA
SVVIYTQEGSSAAAAIQSQRESSELQEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47043	0.067	0.149	8.546E-11	880	0.073	0.185	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
2	AFDB:Q9VWC6	0.053	0.069	5.068E-10	1596	0.100	0.140	Q9VWC6.pdb.gz	Q9VWC6_DROME FI17950p1 OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
3	AFDB:A0A0B4K7S6	0.068	0.076	8.024E-10	1965	0.121	0.138	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
4	AFDB:O95785	0.048	0.061	1.425E-9	1651	0.096	0.131	O95785.pdb.gz	WIZ_HUMAN Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2
5	AFDB:Q8BHZ4	0.059	0.079	1.793E-9	1262	0.085	0.151	Q8BHZ4.pdb.gz	ZN592_MOUSE Zinc finger protein 592 OS=Mus musculus OX=10090 GN=Znf592 PE=1 SV=3
6	AFDB:Q9HCE3	0.041	0.052	2.243E-8	1301	0.073	0.125	Q9HCE3.pdb.gz	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
7	AFDB:Q9VY72	0.036	0.051	8.898E-8	1553	0.105	0.153	Q9VY72.pdb.gz	Q9VY72_DROME Maternal gene required for meiosis, isoform H OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=4
8	AFDB:M9NFI9	0.031	0.032	9.424E-8	2148	0.122	0.128	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
9	AFDB:F1QMZ5	0.035	0.054	1.988E-7	1190	0.088	0.166	F1QMZ5.pdb.gz	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
10	AFDB:O15027	0.040	0.039	2.106E-7	2357	0.138	0.132	O15027.pdb.gz	SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4
11	PDB:3w5kB	0.029	0.251	6.645E-3	110	0.016	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6qx91C	0.019	0.670	2.776E-1	50	0.005	0.240	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:3javA	0.038	0.037	8.755E-1	2327	0.117	0.113	3javA.pdb.gz
14	PDB:5gm6I	0.024	0.323	8.755E-1	102	0.008	0.167	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:5zwmv	0.018	0.217	9.820E-1	174	0.006	0.075	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
16	PDB:7bk0B	0.015	0.092	1.167	250	0.005	0.044	7bk0B.pdb.gz
17	PDB:6lss9	0.019	0.360	1.555	86	0.007	0.186	6lss9.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
18	PDB:2p01A	0.032	0.109	1.744	323	0.016	0.115	2p01A.pdb.gz
19	PDB:6ff47	0.023	0.305	1.847	93	0.010	0.237	6ff47.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:6g90T	0.024	0.069	2.072	462	0.018	0.087	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P2J8	2.45e-47	187	865	0.057	0.149	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
2	G3V9G6	5.43e-47	184	740	0.060	0.181	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
3	Q62788	5.58e-47	184	744	0.060	0.180	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
4	A0A8I6G8Y2	6.93e-47	184	723	0.060	0.185	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
5	Q96MU6	2.92e-46	182	729	0.061	0.188	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
6	O60765	5.40e-46	179	605	0.057	0.212	Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens OX=9606 GN=ZNF354A PE=1 SV=2
7	V9HWI2	5.40e-46	179	605	0.057	0.212	V9HWI2_HUMAN Epididymis luminal protein 104 OS=Homo sapiens OX=9606 GN=HEL104 PE=2 SV=1
8	Q06732	7.85e-46	181	778	0.057	0.166	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
9	Q6NX45	2.29e-45	174	483	0.051	0.236	ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens OX=9606 GN=ZNF774 PE=1 SV=2
10	Q32M78	3.98e-45	177	642	0.057	0.201	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
11	Q08ER8	8.01e-45	176	600	0.056	0.208	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
12	Q02975	8.66e-45	175	576	0.056	0.219	Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus OX=10116 GN=Znf354a PE=2 SV=1
13	P35789	1.38e-44	175	620	0.061	0.223	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
14	Q9UEG4	5.19e-44	177	869	0.053	0.137	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
15	Q6NX49	1.07e-43	174	715	0.054	0.171	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
16	Q8TC21	1.53e-43	169	504	0.055	0.244	ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2
17	Q49A12	1.62e-43	170	536	0.065	0.271	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
18	Q9QXT9	1.84e-43	171	601	0.056	0.208	Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus OX=10090 GN=Znf354b PE=2 SV=1
19	Q03923	2.30e-43	171	595	0.065	0.244	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
20	Q6ZN57	2.35e-43	168	461	0.051	0.247	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	6.6e-10	50.0	Zinc finger, C2H2 type
2	PF12756 zf-C2H2_2	56	15.5	C2H2 type zinc-finger (2 copies)
3	PF13894 zf-C2H2_4	6e-06	37.6	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	2.8e-35	130.4	Zinc-finger double domain
5	PF13909 zf-H2C2_5	8.8e-06	36.7	C2H2-type zinc-finger domain
6	PF12874 zf-met	39	16.0	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299687

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380880	0.798	PQ-loop repeat-containing protein 1
2	9606.ENSP00000305696	0.768	Putative ribosome-binding factor A, mitochondrial
3	9606.ENSP00000269601	0.726	Thioredoxin-like protein 4A
4	9606.ENSP00000377814	0.723	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1
5	9606.ENSP00000299727	0.709	Galanin receptor type 1
6	9606.ENSP00000262198	0.702	Activity-dependent neuroprotector homeobox protein 2
7	9606.ENSP00000323678	0.687	Prostaglandin reductase 3
8	9606.ENSP00000462106	0.662	Small integral membrane protein 21
9	9606.ENSP00000484525	0.617	RNA polymerase II subunit A C-terminal domain phosphatase
10	9606.ENSP00000463762	0.596	Telomere repeats-binding bouquet formation protein 1
11	9606.ENSP00000315654	0.591	Potassium voltage-gated channel subfamily G member 2
12	9606.ENSP00000323584	0.580	Teashirt homolog 1
13	9606.ENSP00000314193	0.551	WD repeat-containing protein 75
14	9606.ENSP00000303525	0.534	Carbonyl reductase family member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.994	DNA binding
GO:0003690	0.815	double-stranded DNA binding
GO:0043565	0.776	sequence-specific DNA binding
GO:0140110	0.684	transcription regulator activity
GO:1990837	0.641	sequence-specific double-stranded DNA binding
GO:0000976	0.609	transcription cis-regulatory region binding
GO:0003700	0.388	DNA-binding transcription factor activity
GO:0000981	0.360	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.319	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050789	0.986	regulation of biological process
GO:0050794	0.938	regulation of cellular process
GO:0051171	0.925	regulation of nitrogen compound metabolic process
GO:0031323	0.920	regulation of cellular metabolic process
GO:0080090	0.916	regulation of primary metabolic process
GO:0010556	0.913	regulation of macromolecule biosynthetic process
GO:0009987	0.840	cellular process
GO:0019219	0.808	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.806	regulation of gene expression
GO:0031326	0.786	regulation of cellular biosynthetic process
GO:0051252	0.540	regulation of RNA metabolic process
GO:0006355	0.379	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.974	intracellular organelle lumen
GO:0031981	0.817	nuclear lumen
GO:0005654	0.799	nucleoplasm
GO:0005737	0.703	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]