StarFunc result for job id Q9C0G6

User Input

>input (1400 residues)
MTFRATDSEFDLTNIEEYAENSALSRLNNIKAKQRVSYVTSTENESDTQILTFRHITKAQ
EKTRKRQQPIKLEPLPVLKVYQDHKQPEYIHEQNRFQLMTAGIIKRPVSIAKKSFATSST
QFLEHQDAVKKMQIHRPYVEVFSPSPPKLPHTGIGKRGLFGTRSSAYPKYTFHDREEVVK
ANIRDPLQIIKIIRENEHLGFLYMIPAVPRSSIEYDTYNLKVVSYENINKNDYYTISQRA
VTHIYNEDIEFIEIDRWEQEYLYHRELTKIPIFSLFRKWKAFSVWRKNVRSKKITGCQKS
LQKNLFIVNPHLRPALLKINELCYHLSFMGLCYIEKCHTYTLQEFKAAQVIRLAEVTERL
GEFRNEAKYVVRRACRFALRAAGFVPDDCAFGPFEDYHKVQSSGSFINTPHELPTYGDSE
KMTYTEQASKRHYCMRLTCFIRLNDYLIENTMHILTVNAVNSLLNHLTDKLKRTPSADVI
QKWITEEKPEVPDKKGTLMVEKQEEDESLIPMFLTELMLTVQSLLFEPSLEDFLDGILGA
VNHCQNTVLSVPNLVPDSYFDAFTSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQI
KETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDA
VALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKL
EFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMK
PSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDK
IRLILNNLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWD
KLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVPQLKYKVEKMKEKLPVI
IDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAA
LEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPL
KTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKE
IMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDEL
LEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSP
EGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQV
ILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTA
LITIDVHARDIVTELVQSKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.307	0.100	6.996E-29	4579	0.128	0.039	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7z8gA	0.310	0.148	2.681E-20	3047	0.091	0.042	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
3	AFDB:Q9VN30	0.213	0.267	3.526E-18	1079	0.095	0.123	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
4	PDB:7kzmC	0.297	0.113	2.677E-13	3890	0.145	0.052	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	PDB:5nugA	0.154	0.084	7.407E-13	2920	0.076	0.036	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
6	PDB:4w8fB	0.232	0.127	1.805E-12	2609	0.059	0.031	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
7	PDB:7mi6A	0.234	0.137	2.758E-12	2419	0.058	0.033	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
8	PDB:7mi8A	0.128	0.204	5.664E-5	868	0.037	0.060	7mi8A.pdb.gz
9	AFDB:F5HSE3	0.058	0.043	2.580E-3	2381	0.111	0.065	F5HSE3.pdb.gz	NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio OX=7955 GN=nipbla PE=2 SV=1
10	AFDB:Q55FT4	0.062	0.047	5.086E-3	2247	0.093	0.058	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
11	PDB:7t3pA	0.061	0.050	1.812E-2	2066	0.104	0.070	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
12	PDB:7useB	0.061	0.072	2.240E-2	1099	0.091	0.116	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
13	PDB:6n1zA	0.055	0.070	2.769E-2	961	0.078	0.113	6n1zA.pdb.gz
14	AFDB:Q10178	0.057	0.062	9.491E-2	1205	0.112	0.130	Q10178.pdb.gz	SF3B1_SCHPO U2 snRNP component prp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp10 PE=1 SV=3
15	AFDB:F1QQZ1	0.070	0.071	1.647E-1	1315	0.103	0.110	F1QQZ1.pdb.gz	F1QQZ1_DANRE Splicing factor 3B subunit 1 isoform X1 OS=Danio rerio OX=7955 GN=sf3b1 PE=1 SV=2
16	AFDB:Q5B9M9	0.048	0.074	1.952E-1	819	0.066	0.114	Q5B9M9.pdb.gz	Q5B9M9_EMENI Topisomerase II associated protein (Pat1), putative (AFU_orthologue AFUA_5G10770) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02751 PE=3 SV=1
17	AFDB:Q9XX00	0.048	0.058	2.740E-1	1113	0.094	0.118	Q9XX00.pdb.gz	SRBPH_CAEEL Sterol regulatory element binding protein sbp-1 OS=Caenorhabditis elegans OX=6239 GN=sbp-1 PE=2 SV=1
18	AFDB:G5EEQ8	0.073	0.076	3.112E-1	1322	0.125	0.132	G5EEQ8.pdb.gz	G5EEQ8_CAEEL Splicing factor 3B subunit 1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sftb-1 PE=1 SV=1
19	AFDB:Q9VI54	0.071	0.097	3.112E-1	905	0.086	0.134	Q9VI54.pdb.gz	Q9VI54_DROME LD29489p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1965 PE=1 SV=3
20	AFDB:O74304	0.056	0.055	3.534E-1	1436	0.099	0.096	O74304.pdb.gz	WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=win1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q0B6	0.0	2425	4144	0.836	0.282	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
2	E9Q3H7	0.0	2425	4092	0.835	0.286	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
3	Q9VWZ3	0.0	671	4081	0.300	0.103	Q9VWZ3_DROME Dynein heavy chain at 16F OS=Drosophila melanogaster OX=7227 GN=Dhc16F PE=3 SV=1
4	Q383F6	1.37e-153	519	4242	0.272	0.090	Q383F6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3010 PE=4 SV=1
5	P0C6F1	5.27e-103	367	4456	0.171	0.054	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
6	Q9P225	2.56e-98	352	4427	0.181	0.057	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
7	Q9P2D7	3.55e-93	336	4265	0.191	0.063	DYH1_HUMAN Dynein axonemal heavy chain 1 OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=6
8	E9Q8T7	1.37e-92	334	4250	0.136	0.045	DYH1_MOUSE Dynein axonemal heavy chain 1 OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1
9	A0A6H2EJG3	6.73e-90	326	4065	0.134	0.046	A0A6H2EJG3_DROME Dynein heavy chain at 36C, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=1
10	Q9VJC6	7.51e-90	326	4024	0.134	0.047	Q9VJC6_DROME Dynein heavy chain at 36C, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=2
11	Q9MBF8	1.56e-81	300	4513	0.141	0.044	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
12	E7FGT8	5.42e-79	291	4626	0.151	0.046	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
13	Q38B68	8.05e-79	291	4142	0.166	0.056	Q38B68_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1720 PE=4 SV=1
14	Q8WXX0	3.46e-78	289	4024	0.136	0.047	DYH7_HUMAN Dynein axonemal heavy chain 7 OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2
15	Q57VT8	4.86e-78	288	4112	0.129	0.044	Q57VT8_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.310 PE=4 SV=1
16	D3YYQ8	9.24e-77	285	4591	0.151	0.046	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
17	F7ABZ6	1.16e-76	284	4534	0.151	0.047	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
18	Q384K3	6.72e-76	282	4152	0.173	0.058	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
19	Q9UFH2	4.35e-73	273	4462	0.169	0.053	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3
20	B1AR51	2.89e-72	270	4484	0.167	0.052	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08393 DHC_N2	3.1e-131	449.8	Dynein heavy chain, N-terminal region 2
2	PF14611 SLS	48	15.3	Mitochondrial inner-membrane-bound regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374045

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380378	0.944	Platelet-activating factor acetylhydrolase IB subunit alpha
2	9606.ENSP00000354791	0.937	Dynactin subunit 1
3	9606.ENSP00000408910	0.936	Dynactin subunit 2
4	9606.ENSP00000479322	0.933	CAP-Gly domain-containing linker protein 1
5	9606.ENSP00000265104	0.924	Dynein heavy chain 5, axonemal
6	9606.ENSP00000333363	0.916	Dynein heavy chain 8, axonemal
7	9606.ENSP00000401514	0.915	Dynein heavy chain 1, axonemal
8	9606.ENSP00000261383	0.913	Dynein heavy chain 3, axonemal
9	9606.ENSP00000312554	0.907	Dynein axonemal heavy chain 12
10	9606.ENSP00000259632	0.901	Dynactin subunit 3
11	9606.ENSP00000221114	0.900	Dynactin subunit 6
12	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
13	9606.ENSP00000289228	0.820	Beta-centractin
14	9606.ENSP00000358921	0.820	Alpha-centractin
15	9606.ENSP00000414906	0.807	Dynactin subunit 4
16	9606.ENSP00000334002	0.804	Huntingtin-associated protein 1
17	9606.ENSP00000300087	0.801	Dynactin subunit 5
18	9606.ENSP00000480538	0.785	Dynein intermediate chain 1, axonemal
19	9606.ENSP00000288912	0.743	Cilia- and flagella-associated protein 251
20	9606.ENSP00000474529	0.683	GAS2-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	1.000	microtubule motor activity
GO:0005488	0.812	binding
GO:0005515	0.798	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007018	0.995	microtubule-based movement
GO:0003341	0.991	cilium movement

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.999	cilium
GO:0005737	0.998	cytoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0032991	0.954	protein-containing complex
GO:0005856	0.928	cytoskeleton
GO:0015630	0.847	microtubule cytoskeleton
GO:0036126	0.789	sperm flagellum
GO:1902494	0.609	catalytic complex
GO:0030286	0.531	dynein complex
GO:0032838	0.516	plasma membrane bounded cell projection cytoplasm
GO:0097014	0.483	ciliary plasm
GO:0005930	0.454	axoneme
GO:0043231	0.304	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]