StarFunc result for job id Q9C0H5

User Input

>input (1083 residues)
MSQTQDYECRSHNVDLPESRIPGSNTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR
IKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASA
ESSPGRGSSVSREGSTSSSLEPEPDTEKAQELPARAGRPAAFGTVKEDSGSSSPPGVFLE
KDYEIYRDYSADGQLLHYRTSSLRWNSGAKERMLIKVADREPSFLAAQGNGYAPDGPPGV
RSRRPSGSQHSPSLQTFAPEADGTIFFPERRPSPFLKRAELPGSSSPLLAQPRKPSGDSQ
PSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEAGGGYQAGSPQRSPGRKPRPFLQPN
KQGPPSPCQQLVLTKQKCPERFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAP
NPGGGSYSLQPSPCLLRDQRLGVKSGDYSTMEGPELRHSQPPTPLPQAQEDAMSWSSQQD
TLSSTGYSPGTRKRKSRKPSLCQATSATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAE
GEAEGARGAAEPFLAQARLAWEAQQAHFHMKQRSSWDSQQDGSGYESDGALPLPMPGPVV
RAFSEDEALAQQENRHWRRGTFEKLGFPQILLEKSVSVQTNLASPEPYLHPSQSEDLAAC
AQFESSRQSRSGVPSSSCVFPTFTLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANML
AWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGL
RDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTK
GVAISTYAKYCYHKLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMGMQR
ERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQWKVPTGLEDPH
VPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAVVHALPRINRMVLCYLIRFLQV
FVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFME
GVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0H5	1.000	1.000	0.000	1083	1.000	1.000	Q9C0H5.pdb.gz	RHG39_HUMAN Rho GTPase-activating protein 39 OS=Homo sapiens OX=9606 GN=ARHGAP39 PE=1 SV=2
2	AFDB:Q9VDE9	0.269	0.226	8.664E-50	1330	0.367	0.298	Q9VDE9.pdb.gz	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
3	PDB:6r3vA	0.160	0.821	3.334E-8	198	0.050	0.273	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
4	AFDB:Q5AMQ3	0.162	0.150	8.876E-8	1176	0.133	0.122	Q5AMQ3.pdb.gz	Q5AMQ3_CANAL Rga2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGA2 PE=4 SV=1
5	PDB:5c2kA	0.159	0.436	1.689E-7	382	0.050	0.141	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
6	AFDB:Q5T5U3	0.168	0.096	6.060E-7	1958	0.175	0.097	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
7	PDB:1xa6A	0.164	0.434	6.907E-7	399	0.041	0.110	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
8	PDB:3cxlA	0.156	0.396	8.194E-7	402	0.037	0.100	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
9	AFDB:Q9P227	0.164	0.122	1.252E-6	1491	0.176	0.128	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
10	AFDB:Q06407	0.160	0.171	2.486E-5	1009	0.134	0.144	Q06407.pdb.gz	RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA2 PE=1 SV=1
11	AFDB:X2JC00	0.156	0.121	2.948E-5	1404	0.144	0.111	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
12	PDB:5jcpA	0.148	0.423	7.892E-5	361	0.040	0.119	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
13	AFDB:Q5VT97	0.169	0.155	2.013E-4	1194	0.135	0.122	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
14	AFDB:Q8IVE3	0.143	0.105	3.819E-4	1493	0.126	0.091	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
15	AFDB:Q54L90	0.155	0.107	5.149E-4	1601	0.118	0.080	Q54L90.pdb.gz	GFLB_DICDI Ras guanine nucleotide exchange factor glfB OS=Dictyostelium discoideum OX=44689 GN=gflB PE=1 SV=1
16	PDB:7kkfA	0.029	0.179	6.442E-1	162	0.010	0.068	7kkfA.pdb.gz
17	PDB:4r0zA	0.079	0.133	7.016E-1	557	0.035	0.068	4r0zA.pdb.gz
18	PDB:3tpoA	0.099	0.172	8.686E-1	438	0.044	0.110	3tpoA.pdb.gz
19	PDB:7sn8D	0.091	0.177	8.686E-1	399	0.050	0.135	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
20	PDB:5abbA	0.057	0.097	9.460E-1	443	0.035	0.086	5abbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0H5	0.0	2237	1083	1.000	1.000	RHG39_HUMAN Rho GTPase-activating protein 39 OS=Homo sapiens OX=9606 GN=ARHGAP39 PE=1 SV=2
2	Q86P77	1.35e-132	436	1309	0.198	0.163	Q86P77_DROME SD01504p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=1
3	Q9VDE9	1.91e-132	436	1330	0.198	0.161	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
4	P18890	3.70e-65	216	101	0.091	0.980	RHG39_RAT Rho GTPase-activating protein 39 (Fragment) OS=Rattus norvegicus OX=10116 GN=Arhgap39 PE=2 SV=2
5	Q7YU00	2.17e-42	169	824	0.066	0.086	Q7YU00_DROME LD10379p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=1
6	Q55CK2	2.67e-39	160	877	0.073	0.090	MGP2_DICDI GTPase activating protein homolog 2 OS=Dictyostelium discoideum OX=44689 GN=mgp2 PE=3 SV=1
7	Q8N264	1.48e-19	97.1	748	0.069	0.100	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
8	Q8C4V1	8.91e-19	94.4	747	0.066	0.096	RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2
9	Q7Z5H3	3.25e-18	92.4	698	0.066	0.103	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
10	P42331	3.18e-17	89.4	645	0.060	0.101	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
11	Q54DW4	3.42e-15	83.2	1350	0.053	0.042	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
12	Q9U1M8	3.40e-14	80.1	2357	0.054	0.025	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
13	Q9VDS5	1.50e-12	74.3	740	0.051	0.074	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
14	Q6PIF6	2.01e-12	74.3	2116	0.030	0.016	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
15	A0A0G2JTE7	5.48e-12	73.2	3494	0.045	0.014	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
16	A0A0G2K1F7	5.77e-12	73.2	3512	0.045	0.014	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
17	Q6NKT5	7.01e-12	70.5	331	0.050	0.163	RGAP5_ARATH Rho GTPase-activating protein 5 OS=Arabidopsis thaliana OX=3702 GN=ROPGAP5 PE=2 SV=1
18	Q9W4A9	7.04e-12	71.6	494	0.058	0.128	Q9W4A9_DROME Rho GTPase activating protein at 5A, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGAP5A PE=4 SV=1
19	E7F3F0	8.57e-12	72.4	2286	0.061	0.029	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
20	Q54GD0	5.04e-11	69.7	920	0.046	0.054	MGP1_DICDI GTPase activating protein homolog 1 OS=Dictyostelium discoideum OX=44689 GN=mgp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00784 MyTH4	1.1e-31	120.7	MyTH4 domain
2	PF00620 RhoGAP	2.3e-26	103.9	RhoGAP domain
3	PF00397 WW	6e-05	34.3	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366522

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348461	0.929	Ras-related C3 botulinum toxin substrate 1
2	9606.ENSP00000368824	0.888	Connector enhancer of kinase suppressor of ras 2
3	9606.ENSP00000420321	0.867	Roundabout homolog 1
4	9606.ENSP00000422591	0.771	Slit homolog 2 protein
5	9606.ENSP00000304945	0.739	Roundabout homolog 4
6	9606.ENSP00000435565	0.633	Maestro heat like repeat family member 1
7	9606.ENSP00000417335	0.619	Roundabout homolog 2
8	9606.ENSP00000292539	0.583	Protein phosphatase 1 regulatory subunit 16A
9	9606.ENSP00000352163	0.573	LY6/PLAUR domain containing 2
10	9606.ENSP00000314380	0.572	Protein lifeguard 1
11	9606.ENSP00000387426	0.564	Cysteine and histidine rich 1
12	9606.ENSP00000246515	0.555	Secreted Ly-6/uPAR-related protein 1
13	9606.ENSP00000363371	0.524	Connector enhancer of kinase suppressor of ras 1
14	9606.ENSP00000292430	0.503	Lymphocyte antigen 6K
15	9606.ENSP00000314724	0.501	Liprin-beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.951	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051056	0.986	regulation of small GTPase mediated signal transduction
GO:0009987	0.985	cellular process
GO:0016043	0.979	cellular component organization
GO:0034330	0.707	cell junction organization
GO:0099173	0.675	postsynapse organization
GO:0050896	0.456	response to stimulus
GO:0051716	0.379	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0030054	0.992	cell junction
GO:0045202	0.944	synapse
GO:0098978	0.912	glutamatergic synapse
GO:0043226	0.742	organelle
GO:0043227	0.602	membrane-bounded organelle
GO:0043229	0.319	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]