StarFunc result for job id Q9C0H9

User Input

>input (1183 residues)
MGNAPSQDPERSSPPMLSADDAEYPREYRTLGGGGGGGSGGRRFSNVGLVHTSERRHTVI
AAQSLEALSGLQKADADRKRDAFMDHLKSKYPQHALALRGQQDRMREQPNYWSFKTRSSR
HTQGAQPGLADQAAKLSYASAESLETMSEAELPLGFSRMNRFRQSLPLSRSASQTKLRSP
GVLFLQFGEETRRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVF
YELEDVRDIQDRSIIKIYRKEPLYAAFPGSHLTNGDLRREMVYASRESSPTRRLNNLSPA
PHLASGSPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPPSYAGSPVHHAAERLGGAPAAQG
VSPSPSAILERRDVKPDEDLASKAGGMVLVKGEGLYADPYGLLHEGRLSLAAAAGDPFAY
PGAGGLYKRGSVRSLSTYSAAALQSDLEDSLYKAAGGGGPLYGDGYGFRLPPSSPQKLAD
VAAPPGGPPPPHSPYSGPPSRGSPVRQSFRKDSGSSSVFAESPGGKTRSAGSASTAGAPP
SELFPGPGERSLVGFGPPVPAKDTETRERMEAMEKQIASLTGLVQSALLRGSEPETPSEK
IEGSNGAATPSAPCGSGGRSSGATPVSGPPPPSASSTPAGQPTAVSRLQMQLHLRGLQNS
ASDLRGQLQQLRKLQLQNQESVRALLKRTEAELSMRVSEAARRQEDPLQRQRTLVEEERL
RYLNDEELITQQLNDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHF
PGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRRQVDEGVWPPPNNL
LSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKR
SVDKAVSVEAAERDWEEKRAALTQYSAKDINRLLEETQAELLKAIPDLDCASKAHPGPAP
TPDHKPPKAPHGQKAAPRTEPSGRRGSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGLT
TTRTGEVVVTSKKDSAFIKKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDED
DEDRIIAELESGGGSVPPMKVVTPGASRLKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQA
TKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSISF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QXY2	0.323	0.320	0.000	1197	0.922	0.911	Q9QXY2.pdb.gz	SRCN1_RAT SRC kinase signaling inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Srcin1 PE=1 SV=1
2	AFDB:Q5T5P2	0.102	0.071	1.916E-45	1943	0.383	0.233	Q5T5P2.pdb.gz	SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2
3	AFDB:Q99550	0.052	0.052	4.731E-5	1183	0.134	0.134	Q99550.pdb.gz	MPP9_HUMAN M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9 PE=1 SV=6
4	AFDB:A8JNK1	0.054	0.052	5.036E-5	1241	0.136	0.130	A8JNK1.pdb.gz	A8JNK1_DROME Ensconsin, isoform F OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
5	AFDB:M9NFQ7	0.066	0.077	1.988E-4	962	0.125	0.154	M9NFQ7.pdb.gz	M9NFQ7_DROME RNA-binding Fox protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=1
6	AFDB:Q9W179	0.077	0.057	1.988E-4	1703	0.150	0.105	Q9W179.pdb.gz	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
7	AFDB:E7FCY1	0.066	0.069	2.116E-4	1124	0.117	0.123	E7FCY1.pdb.gz	E7FCY1_DANRE Centromere protein J OS=Danio rerio OX=7955 GN=cenpj PE=1 SV=1
8	AFDB:A2AUY4	0.062	0.037	3.078E-4	2123	0.161	0.090	A2AUY4.pdb.gz	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
9	AFDB:Q9HCH0	0.036	0.033	3.712E-4	1334	0.177	0.157	Q9HCH0.pdb.gz	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
10	AFDB:Q9VV52	0.049	0.051	4.205E-4	1117	0.145	0.153	Q9VV52.pdb.gz	Q9VV52_DROME LD37257p OS=Drosophila melanogaster OX=7227 GN=RAF2 PE=1 SV=3
11	PDB:2y3aA	0.060	0.071	3.182E-3	976	0.009	0.011	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
12	PDB:7lq1A	0.061	0.075	5.242E-3	950	0.013	0.016	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
13	PDB:4pyuA	0.054	0.610	5.580E-3	76	0.011	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
14	PDB:5xqmA	0.054	0.506	5.939E-3	90	0.008	0.100	5xqmA.pdb.gz
15	PDB:7rbsB	0.050	0.283	9.194E-3	157	0.007	0.051	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
16	PDB:3plvA	0.053	0.566	9.786E-3	80	0.009	0.138	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
17	PDB:3tixA	0.054	0.336	1.256E-2	153	0.016	0.124	3tixA.pdb.gz
18	PDB:6yvaC	0.053	0.328	1.337E-2	155	0.007	0.052	6yvaC.pdb.gz
19	PDB:5itdA	0.061	0.072	1.827E-2	995	0.008	0.009	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
20	PDB:4zynB	0.051	0.140	2.070E-2	385	0.009	0.029	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0H9	0.0	2369	1183	1.000	1.000	SRCN1_HUMAN SRC kinase signaling inhibitor 1 OS=Homo sapiens OX=9606 GN=SRCIN1 PE=1 SV=4
2	Q9QWI6	0.0	1935	1250	0.919	0.870	SRCN1_MOUSE SRC kinase signaling inhibitor 1 OS=Mus musculus OX=10090 GN=Srcin1 PE=1 SV=2
3	Q9QXY2	0.0	1985	1197	0.921	0.911	SRCN1_RAT SRC kinase signaling inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Srcin1 PE=1 SV=1
4	A2AQ25	7.87e-169	550	1946	0.373	0.227	SKT_MOUSE Sickle tail protein OS=Mus musculus OX=10090 GN=Skt PE=1 SV=1
5	Q5T5P2	3.28e-168	548	1943	0.305	0.186	SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2
6	H2L0S5	2.23e-09	64.3	836	0.055	0.078	H2L0S5_CAEEL Actin interacting protein 3-like C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y71H2AM.15 PE=1 SV=1
7	Q3V5J3	2.37e-09	64.3	832	0.055	0.078	Q3V5J3_CAEEL Actin interacting protein 3-like C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y71H2AM.15 PE=1 SV=1
8	Q86SQ0	0.22	38.1	1253	0.027	0.026	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
9	Q7TS99	0.23	37.4	240	0.025	0.121	HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus OX=10090 GN=Helt PE=1 SV=1
10	Q0VAL7	1.6	33.9	162	0.022	0.160	Q0VAL7_HUMAN C21orf58 protein OS=Homo sapiens OX=9606 GN=C21orf58 PE=1 SV=1
11	Q28021	1.6	35.4	1388	0.036	0.031	ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus OX=9913 GN=ROCK2 PE=1 SV=1
12	Q62868	2.2	35.0	1388	0.038	0.032	ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Rock2 PE=1 SV=2
13	E7F1U3	2.6	34.7	774	0.031	0.048	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
14	P70336	2.7	34.7	1388	0.038	0.032	ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Rock2 PE=1 SV=1
15	Q803M1	3.0	33.9	248	0.038	0.181	Q803M1_DANRE Tropomyosin 3 OS=Danio rerio OX=7955 GN=cb674 PE=1 SV=1
16	Q38CZ5	3.1	34.3	461	0.041	0.104	Q38CZ5_TRYB2 Trypanin-related protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2800 PE=3 SV=1
17	A0A2P9DU05	6.3	33.5	1388	0.037	0.032	A0A2P9DU05_HUMAN Rho-associated protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=2 SV=1
18	O75116	6.3	33.5	1388	0.037	0.032	ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4
19	M3TYT0	7.3	33.1	1388	0.035	0.030	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
20	Q2QY10	9.3	32.3	292	0.017	0.068	CBP_ORYSJ Calcium-binding protein CBP OS=Oryza sativa subsp. japonica OX=39947 GN=CBP PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03915 AIP3	6.9e-11	53.5	Actin interacting protein 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484715

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233121	0.975	Microtubule-associated protein RP/EB family member 3
2	9606.ENSP00000362680	0.956	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000254976	0.951	Synaptosomal-associated protein 25
4	9606.ENSP00000365745	0.911	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
5	9606.ENSP00000263233	0.809	Synaptophysin
6	9606.ENSP00000302629	0.733	Chondroitin sulfate synthase 3
7	9606.ENSP00000382428	0.720	Disks large homolog 4
8	9606.ENSP00000400258	0.695	Disks large-associated protein 2
9	9606.ENSP00000411831	0.683	Kinesin-like protein KIF21B
10	9606.ENSP00000220003	0.653	Tyrosine-protein kinase CSK
11	9606.ENSP00000442563	0.642	DNA polymerase subunit gamma-2, mitochondrial
12	9606.ENSP00000240123	0.633	Vinexin
13	9606.ENSP00000391669	0.578	Breast cancer anti-estrogen resistance protein 1
14	9606.ENSP00000261837	0.570	Guanine nucleotide-binding protein subunit beta-5
15	9606.ENSP00000376306	0.561	Citron Rho-interacting kinase
16	9606.ENSP00000387694	0.525	Solute carrier family 12 member 5
17	9606.ENSP00000324302	0.519	Syntaxin-binding protein 6
18	9606.ENSP00000427866	0.516	Dematin
19	9606.ENSP00000418994	0.512	Synaptoporin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.870	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0048519	0.951	negative regulation of biological process
GO:0048523	0.939	negative regulation of cellular process
GO:0009987	0.924	cellular process
GO:0051128	0.738	regulation of cellular component organization
GO:0071840	0.535	cellular component organization or biogenesis
GO:0048518	0.496	positive regulation of biological process
GO:0048522	0.493	positive regulation of cellular process
GO:0016043	0.484	cellular component organization
GO:0065008	0.471	regulation of biological quality
GO:0051049	0.398	regulation of transport
GO:0050807	0.348	regulation of synapse organization
GO:0050896	0.300	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.998	synapse
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005856	0.993	cytoskeleton
GO:0005737	0.985	cytoplasm
GO:0071944	0.920	cell periphery
GO:0015629	0.890	actin cytoskeleton
GO:0043231	0.826	intracellular membrane-bounded organelle
GO:0005886	0.820	plasma membrane
GO:0098794	0.708	postsynapse
GO:0005829	0.413	cytosol
GO:0099572	0.340	postsynaptic specialization
GO:0098984	0.300	neuron to neuron synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]