StarFunc result for job id Q9C0I4

User Input

>input (1606 residues)
MFPKSNLTVTCWVWRSMRKLFLLLSLLLSHAAHLEGKKDNQFIWKPGPWGRCTGDCGPGG
VQSRAVWCFHVDGWTSHLSNCGESNRPPKERSCFRVCDWHSDLFQWEVSDWHHCVLVPYA
RGEVKPRTAECVTAQHGLQHRMVRCIQKLNRTVVANEICEHFALQPPTEQACLIPCPRDC
VVSEFLPWSNCSKGCGKKLQHRTRAVIAPPLFGGLQCPNLTESRACDAPISCPLGEEEYT
FSLKVGPWSKCRLPHLKEINPSGRTVLDFNSDSNERVTFKHQSYKAHHHSKSWAIEIGYQ
TRQVSCTRSDGQNAMLSLCLQDSFPLTVQSCIMPKDCETSQWSSWSPCSKTCRSGSLLPG
FRSRSRNVKHMAIGGGKECPELLEKEACIVEGELLQQCPRYSWRTSEWKECQVSLLLEQQ
DPHWHVTGPVCGGGIQTREVYCAQSVPAAAALRAKEVSRPVEKALCVGPAPLPSQLCNIP
CSTDCIVSSWSAWGLCIHENCHDPQGKKGFRTRQRHVLMESTGPAGHCPHLVESVPCEDP
MCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRM
DCVLSEWTEWSSCSQSCSNKNSDGKQTRSRTILALAGEGGKPCPPSQALQEHRLCNDHSC
MQLHWETSPWGPCSEDTLVTALNATIGWNGEATCGVGIQTRRVFCVKSHVGQVMTKRCPD
STRPETVRPCFLPCKKDCIVTAFSEWTPCPRMCQAGNATVKQSRYRIIIQEAANGGQECP
DTLYEERECEDVSLCPVYRWKPQKWSPCILVPESVWQGITGSSEACGKGLQTRAVSCISD
DNRSAEMMECLKQTNGMPLLVQECTVPCREDCTFTAWSKFTPCSTNCEATKSRRRQLTGK
SRKKEKCQDSDLYPLVETELCPCDEFISQPYGNWSDCILPEGRREPHRGLRVQADSKECG
EGLRFRAVACSDKNGRPVDPSFCSSSGYIQEKCVIPCPFDCKLSDWSSWGSCSSSCGIGV
RIRSKWLKEKPYNGGRPCPKLDLKNQVHEAVPCYSECNQYSWVVEHWSSCKINNELRSLR
CGGGTQSRKIRCVNTADGEGGAVDSNLCNQDEIPPETQSCSLMCPNECVMSEWGLWSKCP
QSCDPHTMQRRTRHLLRPSLNSRTCAEDSQVQPCLLNENCFQFQYNLTEWSTCQLSENAP
CGQGVRTRLLSCVCSDGKPVSMDQCEQHNLEKPQRMSIPCLVECVVNCQLSGWTAWTECS
QTCGHGGRMSRTRFIIMPTQGEGRPCPTELTQEKTCPVTPCYSWVLGNWSACKLEGGDCG
EGVQIRSLSCMVHSGSISHAAGRVEDALCGEMPFQDSILKQLCSVPCPGDCHLTEWSEWS
TCELTCIDGRSFETVGRQSRSRTFIIQSFENQDSCPQQVLETRPCTGGKCYHYTWKASLW
NNNERTVWCQRSDGVNVTGGCSPQARPAAIRQCIPACRKPFSYCTQGGVCGCEKGYTEIM
KSNGFLDYCMKVPGSEDKKADVKNLSGKNRPVNSKIHDIFKGWSLQPLDPDGRVKIWVYG
VSGGAFLIMIFLIFTSYLVCKKPKPHQSTPPQQKPLTLAYDGDLDM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7MBS7	0.494	0.476	0.000	1686	0.494	0.470	A7MBS7.pdb.gz	THS7A_DANRE Thrombospondin type-1 domain-containing protein 7A OS=Danio rerio OX=7955 GN=thsd7aa PE=1 SV=2
2	AFDB:Q9C0I4	1.000	1.000	0.000	1606	1.000	1.000	Q9C0I4.pdb.gz	THS7B_HUMAN Thrombospondin type-1 domain-containing protein 7B OS=Homo sapiens OX=9606 GN=THSD7B PE=1 SV=3
3	AFDB:Q9UPZ6	0.639	0.622	0.000	1657	0.507	0.492	Q9UPZ6.pdb.gz	THS7A_HUMAN Thrombospondin type-1 domain-containing protein 7A OS=Homo sapiens OX=9606 GN=THSD7A PE=1 SV=4
4	AFDB:Q9UKP4	0.054	0.051	8.333E-20	1686	0.134	0.128	Q9UKP4.pdb.gz	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
5	AFDB:Q6ZMP0	0.055	0.072	6.449E-18	1018	0.126	0.199	Q6ZMP0.pdb.gz	THSD4_HUMAN Thrombospondin type-1 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=THSD4 PE=1 SV=2
6	AFDB:Q3UTY6	0.065	0.095	1.005E-17	1018	0.113	0.179	Q3UTY6.pdb.gz	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
7	AFDB:Q6UY14	0.060	0.078	1.148E-17	1074	0.128	0.192	Q6UY14.pdb.gz	ATL4_HUMAN ADAMTS-like protein 4 OS=Homo sapiens OX=9606 GN=ADAMTSL4 PE=1 SV=2
8	AFDB:P58397	0.058	0.058	3.640E-17	1594	0.120	0.120	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
9	AFDB:Q80T21	0.061	0.079	3.640E-17	1036	0.133	0.207	Q80T21.pdb.gz	ATL4_MOUSE ADAMTS-like protein 4 OS=Mus musculus OX=10090 GN=Adamtsl4 PE=2 SV=1
10	AFDB:Q811B3	0.059	0.059	7.404E-17	1600	0.123	0.124	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
11	PDB:1w0rA	0.054	0.148	1.032E-9	442	0.054	0.197	1w0rA.pdb.gz
12	PDB:5a42A	0.033	0.033	2.341E-5	1597	0.067	0.067	5a42A.pdb.gz
13	PDB:3t5oA	0.055	0.092	1.321E-4	871	0.057	0.104	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
14	PDB:7q1yA	0.039	0.043	1.321E-4	1374	0.055	0.065	7q1yA.pdb.gz
15	PDB:6h03A	0.036	0.043	3.070E-4	1223	0.055	0.072	6h03A.pdb.gz
16	PDB:4rtdA	0.038	0.047	7.134E-4	1122	0.045	0.065	4rtdA.pdb.gz
17	PDB:4e0sB	0.050	0.080	9.310E-4	898	0.070	0.126	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
18	PDB:7nycC	0.035	0.059	9.733E-4	809	0.067	0.133	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:7vonA	0.038	0.043	1.215E-3	1399	0.066	0.076	7vonA.pdb.gz
20	PDB:7nydE	0.036	0.103	2.364E-3	484	0.042	0.138	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7MBS7	0.0	1559	1686	0.496	0.473	THS7A_DANRE Thrombospondin type-1 domain-containing protein 7A OS=Danio rerio OX=7955 GN=thsd7aa PE=1 SV=2
2	Q69ZU6	0.0	1571	1645	0.502	0.491	THS7A_MOUSE Thrombospondin type-1 domain-containing protein 7A OS=Mus musculus OX=10090 GN=Thsd7a PE=1 SV=2
3	Q9C0I4	0.0	3286	1606	1.000	1.000	THS7B_HUMAN Thrombospondin type-1 domain-containing protein 7B OS=Homo sapiens OX=9606 GN=THSD7B PE=1 SV=3
4	Q9UPZ6	0.0	1591	1657	0.507	0.492	THS7A_HUMAN Thrombospondin type-1 domain-containing protein 7A OS=Homo sapiens OX=9606 GN=THSD7A PE=1 SV=4
5	Q9P2N4	7.98e-26	119	1935	0.121	0.101	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
6	F1SFS3	3.31e-25	117	2000	0.141	0.113	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
7	H0Y859	4.36e-25	116	991	0.123	0.199	H0Y859_HUMAN ADAM metallopeptidase with thrombospondin type 1 motif 9 (Fragment) OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=1
8	Q9HCB6	5.51e-24	112	807	0.065	0.130	SPON1_HUMAN Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV=2
9	Q19791	3.56e-23	110	2150	0.162	0.121	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
10	H2L2A7	3.91e-23	110	2165	0.162	0.120	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1
11	P59511	6.40e-23	109	1906	0.144	0.122	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
12	Q8VCC9	8.21e-23	108	807	0.066	0.131	SPON1_MOUSE Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 SV=1
13	P59510	1.49e-20	102	1910	0.126	0.106	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
14	O42114	2.96e-17	90.5	803	0.064	0.127	O42114_DANRE Spondin-1 OS=Danio rerio OX=7955 GN=cb1051 PE=2 SV=1
15	F1R2Z9	3.25e-17	90.1	804	0.064	0.127	F1R2Z9_DANRE Spondin-1 OS=Danio rerio OX=7955 GN=F-spondin2 PE=4 SV=3
16	E9PYV8	1.43e-16	88.6	1350	0.130	0.155	E9PYV8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
17	E9PUN6	2.95e-16	87.8	1931	0.131	0.109	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
18	Q8CDB8	1.42e-15	84.7	701	0.091	0.208	Q8CDB8_MOUSE GON domain-containing protein OS=Mus musculus OX=10090 GN=Adamts9 PE=2 SV=1
19	Q60519	7.43e-14	79.7	1093	0.068	0.100	SEM5B_MOUSE Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b PE=2 SV=2
20	D3YXG0	1.72e-13	79.0	5634	0.065	0.019	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00274 Glycolytic	3.6e+02	11.2	Fructose-bisphosphate aldolase class-I
2	PF19030 TSP1_ADAMTS	9.3e-43	155.6	Thrombospondin type 1 domain
3	PF19035 TSP1_CCN	1.7e+02	13.9	CCN3 Nov like TSP1 domain
4	PF19028 TSP1_spondin	9.8e-102	344.5	Spondin-like TSP1 domain
5	PF00090 TSP_1	3.5e-35	131.2	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360997	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 13
2	9606.ENSP00000247153	0.910	Properdin
3	9606.ENSP00000460236	0.908	Spondin-1
4	9606.ENSP00000371936	0.907	Semaphorin-5A
5	9606.ENSP00000355751	0.905	Thrombospondin-2
6	9606.ENSP00000406482	0.905	Thrombospondin type-1 domain-containing protein 7A
7	9606.ENSP00000389588	0.904	Semaphorin-5B
8	9606.ENSP00000260356	0.903	Thrombospondin-1
9	9606.ENSP00000282849	0.903	ADAM metallopeptidase with thrombospondin type 1 motif 18
10	9606.ENSP00000483599	0.903	Spondin-2
11	9606.ENSP00000257359	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 8
12	9606.ENSP00000284987	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 5
13	9606.ENSP00000286657	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 3
14	9606.ENSP00000299164	0.902	ADAM metallopeptidase with thrombospondin type 1 motif 15
15	9606.ENSP00000339613	0.902	GDP-fucose protein O-fucosyltransferase 2
16	9606.ENSP00000369921	0.902	ADAMTS-like protein 1
17	9606.ENSP00000374071	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 20
18	9606.ENSP00000418735	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 9
19	9606.ENSP00000422554	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 12
20	9606.ENSP00000268070	0.901	ADAM metallopeptidase with thrombospondin type 1 motif 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.516	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.975	cellular component organization
GO:0032501	0.903	multicellular organismal process
GO:0032502	0.837	developmental process
GO:0048856	0.804	anatomical structure development
GO:0007275	0.764	multicellular organism development
GO:0050789	0.705	regulation of biological process
GO:0048731	0.643	system development
GO:0050794	0.622	regulation of cellular process
GO:0030154	0.363	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	1.000	membrane
GO:0005886	0.994	plasma membrane
GO:0005622	0.396	intracellular anatomical structure
GO:0043226	0.375	organelle
GO:0005737	0.365	cytoplasm
GO:0043227	0.336	membrane-bounded organelle
GO:0043231	0.324	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]