StarFunc result for job id Q9C0J1

User Input

>input (378 residues)
MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLRKAAKPAGDPT
AHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFL
LLAIKSQPGHVERRAAIRSTWGRVGGWARGRQLKLVFLLGVAGSAPPAQLLAYESREFDD
ILQWDFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLDGWDPAQD
LLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAEL
FPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMW
ALVTDEGLKCAAGPIPQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0J1	1.000	1.000	1.384E-81	378	1.000	1.000	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
2	AFDB:Q9Y2A9	0.761	0.773	5.526E-42	372	0.384	0.390	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
3	AFDB:Q6ZMB0	0.765	0.754	2.335E-39	384	0.394	0.388	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
4	AFDB:Q8K0J2	0.764	0.728	6.595E-39	397	0.407	0.388	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
5	AFDB:Q8NFL0	0.761	0.718	1.459E-38	401	0.410	0.387	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
6	AFDB:Q9Z222	0.741	0.706	2.467E-36	397	0.386	0.368	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
7	AFDB:Q9NY97	0.732	0.698	2.512E-35	397	0.376	0.358	Q9NY97.pdb.gz	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
8	PDB:7jhiC	0.739	0.841	1.099E-34	331	0.352	0.402	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
9	AFDB:Q7Z7M8	0.707	0.674	3.246E-31	397	0.344	0.327	Q7Z7M8.pdb.gz	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
10	AFDB:O54904	0.654	0.755	1.163E-27	326	0.265	0.307	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
11	AFDB:Q9Y2C3	0.659	0.799	2.277E-27	310	0.233	0.284	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
12	PDB:4y63A	0.317	0.405	1.462E-5	282	0.079	0.106	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
13	PDB:6fxrA	0.334	0.199	1.984E-5	700	0.087	0.047	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:4fixA	0.351	0.227	9.134E-5	629	0.090	0.054	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
15	PDB:1ll0B	0.369	0.490	1.240E-4	267	0.093	0.131	1ll0B.pdb.gz
16	PDB:7x8kB	0.281	0.288	1.240E-4	367	0.101	0.104	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
17	PDB:5mlzA	0.294	0.309	1.489E-4	355	0.079	0.085	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
18	PDB:7d72A	0.297	0.280	2.427E-4	407	0.101	0.093	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
19	PDB:2gamC	0.357	0.360	4.751E-4	374	0.095	0.096	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
20	PDB:2oi6B	0.314	0.271	5.050E-4	452	0.066	0.055	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0J1	0.0	771	378	1.000	1.000	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
2	Q8NFL0	2.48e-88	274	401	0.413	0.389	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
3	Q8K0J2	7.68e-87	270	397	0.378	0.360	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
4	Q6ZMB0	3.04e-81	255	384	0.360	0.354	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
5	Q9Z222	1.01e-79	251	397	0.365	0.348	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
6	Q9Y2A9	1.45e-78	248	372	0.347	0.352	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
7	Q9NY97	3.88e-78	248	397	0.354	0.338	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
8	Q7Z7M8	6.93e-45	161	397	0.307	0.292	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
9	O54904	1.39e-44	158	326	0.230	0.267	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
10	Q9Y5Z6	1.39e-44	158	326	0.230	0.267	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
11	Q9BYG0	1.71e-44	159	378	0.241	0.241	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
12	Q99NB2	4.62e-44	158	377	0.241	0.241	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
13	Q8BGY6	1.03e-41	152	376	0.228	0.229	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
14	O54905	8.27e-39	145	422	0.225	0.201	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
15	O43825	2.15e-38	144	422	0.222	0.199	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
16	Q9Y2C3	3.17e-38	141	310	0.225	0.274	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
17	Q9JI67	4.31e-38	140	308	0.217	0.266	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
18	O75752	4.96e-34	130	331	0.228	0.260	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
19	Q920V1	1.89e-32	126	331	0.225	0.257	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
20	O96024	2.81e-32	127	378	0.254	0.254	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04646 DUF604	3.7e+02	11.9	Protein of unknown function, DUF604
2	PF02434 Fringe	3.7e-06	38.1	Fringe-like
3	PF01762 Galactosyl_T	1.7e-39	147.2	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319636

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310696	0.966	Beta-1,4-galactosyltransferase 2
2	9606.ENSP00000420161	0.962	Beta-1,4-galactosyltransferase 4
3	9606.ENSP00000369055	0.952	Beta-1,4-galactosyltransferase 1
4	9606.ENSP00000312021	0.950	Galactoside 2-alpha-L-fucosyltransferase 1
5	9606.ENSP00000480428	0.940	Beta-1,4-galactosyltransferase 3
6	9606.ENSP00000305603	0.935	Galactoside 3(4)-L-fucosyltransferase
7	9606.ENSP00000302599	0.933	Alpha-(1,3)-fucosyltransferase 9
8	9606.ENSP00000387498	0.932	Galactoside 2-alpha-L-fucosyltransferase 2
9	9606.ENSP00000313398	0.923	Alpha-(1,3)-fucosyltransferase 6
10	9606.ENSP00000466880	0.919	Alpha-(1,3)-fucosyltransferase 5
11	9606.ENSP00000480884	0.913	Type 2 lactosamine alpha-2,3-sialyltransferase
12	9606.ENSP00000351602	0.909	Alpha-(1,3)-fucosyltransferase 4
13	9606.ENSP00000381008	0.908	Mucin-16
14	9606.ENSP00000302716	0.903	Mucin-17
15	9606.ENSP00000262551	0.902	Mimecan
16	9606.ENSP00000266718	0.902	Lumican
17	9606.ENSP00000266719	0.902	Keratocan
18	9606.ENSP00000343924	0.902	Prolargin
19	9606.ENSP00000347041	0.902	Fibromodulin
20	9606.ENSP00000364700	0.902	Osteomodulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048531	1.000	beta-1,3-galactosyltransferase activity
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0008499	0.991	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0005515	0.786	protein binding
GO:0008532	0.306	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901576	0.997	organic substance biosynthetic process
GO:0005975	0.997	carbohydrate metabolic process
GO:0006022	0.996	aminoglycan metabolic process
GO:0036211	0.996	protein modification process
GO:0009100	0.995	glycoprotein metabolic process
GO:0009101	0.993	glycoprotein biosynthetic process
GO:0043413	0.992	macromolecule glycosylation
GO:0016051	0.992	carbohydrate biosynthetic process
GO:0006023	0.986	aminoglycan biosynthetic process
GO:0006486	0.983	protein glycosylation
GO:0005976	0.962	polysaccharide metabolic process
GO:0006493	0.941	protein O-linked glycosylation
GO:0000271	0.931	polysaccharide biosynthetic process
GO:0034637	0.922	cellular carbohydrate biosynthetic process
GO:1903510	0.902	mucopolysaccharide metabolic process
GO:0044272	0.894	sulfur compound biosynthetic process
GO:0006024	0.884	glycosaminoglycan biosynthetic process
GO:0044264	0.882	cellular polysaccharide metabolic process
GO:0033692	0.683	cellular polysaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0070013	0.509	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14389	0.306	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.149	0.306	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase.

[back to server]