StarFunc result for job id Q9C0J8

User Input

>input (1336 residues)
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYN
PSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC
PVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTAD
HGGYVKYWQSNMNNVKMFQAHKEAIREASFSPTDNKFATCSDDGTVRIWDFLRCHEERIL
RGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKLNLNG
NWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATAVAWHPVHEGLFASGGSDGSLLFWH
VGVEKEVGGMEMAHEGMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGDKMRDRYNLNLL
PGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQEQMGKDESNEIEMTIPGLDWGMEE
VMQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKVPIPAPNEVLNDRKEDIKLEEKKKTQAE
IEQEMATLQYTNPQLLEQLKIERLAQKQVEQIQPPPSSGTPLLGPQPFPGQGPMSQIPQG
FQQPHPSQQMPMNMAQMGPPGPQGQFRPPGPQGQMGPQGPPLHQGGGGPQGFMGPQGPQG
PPQGLPRPQDMHGPQGMQRHPGPHGPLGPQGPPGPQGSSGPQGHMGPQGPPGPQGHIGPQ
GPPGPQGHLGPQGPPGTQGMQGPPGPRGMQGPPHPHGIQGGPGSQGIQGPVSQGPLMGLN
PRGMQGPPGPRENQGPAPQGMIMGHPPQEMRGPHPPGGLLGHGPQEMRGPQEIRGMQGPP
PQGSMLGPPQELRGPPGSQSQQGPPQGSLGPPPQGGMQGPPGPQGQQNPARGPHPSQGPI
PFQQQKTPLLGDGPRAPFNQEGQSTGPPPLIPGLGQQGAQGRIPPLNPGQGPGPNKGDSR
GPPNHHMGPMSERRHEQSGGPEHGPERGPFRGGQDCRGPPDRRGPHPDFPDDFSRPDDFH
PDKRFGHRLREFEGRGGPLPQEEKWRRGGPGPPFPPDHREFSEGDGRGAARGPPGAWEGR
RPGDERFPRDPEDPRFRGRREESFRRGAPPRHEGRAPPRGRDGFPGPEDFGPEENFDASE
EAARGRDLRGRGRGTPRGGRKGLLPTPDEFPRFEGGRKPDSWDGNREPGPGHEHFRDTPR
PDHPPHDGHSPASRERSSSLQGMDMASLPPRKRPWHDGPGTSEHREMEAPGGPSEDRGGK
GRGGPGPAQRVPKSGRSSSLDGEHHDGYHRDEPFGGPPGSGTPSRGGRSGSNWGRGSNMN
SGPPRRGASRGGGRGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0J8	0.999	0.999	0.000	1336	1.000	1.000	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
2	PDB:7zgrD	0.256	0.851	7.035E-39	395	0.106	0.359	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
3	PDB:5mzhB	0.205	0.601	2.384E-24	415	0.061	0.195	5mzhB.pdb.gz
4	PDB:5nnzA	0.197	0.703	3.151E-24	335	0.053	0.212	5nnzA.pdb.gz
5	PDB:7mq8LU	0.213	0.620	1.991E-23	445	0.053	0.160	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:2h9lA	0.211	0.838	2.632E-23	321	0.060	0.249	2h9lA.pdb.gz
7	PDB:5jcsq	0.202	0.515	5.753E-23	488	0.057	0.156	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
8	PDB:7bt6x	0.197	0.501	1.330E-22	488	0.050	0.137	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
9	PDB:5nzrC	0.204	0.318	1.572E-22	843	0.051	0.081	5nzrC.pdb.gz
10	PDB:5o9zL	0.200	0.556	2.906E-22	459	0.051	0.148	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
11	PDB:6bk8D	0.212	0.752	4.063E-22	359	0.052	0.195	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
12	AFDB:Q389F7	0.199	0.239	6.905E-20	1105	0.142	0.172	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
13	AFDB:O43379	0.203	0.179	2.913E-18	1518	0.122	0.107	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
14	AFDB:F1LRR4	0.198	0.172	3.257E-18	1551	0.118	0.101	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
15	AFDB:M9PB01	0.198	0.113	3.257E-18	2397	0.147	0.082	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
16	AFDB:O60336	0.202	0.179	1.392E-17	1514	0.142	0.125	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
17	AFDB:Q6NS57	0.199	0.178	3.217E-17	1503	0.139	0.124	Q6NS57.pdb.gz	MABP1_MOUSE Mitogen-activated protein kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Mapkbp1 PE=1 SV=1
18	AFDB:Q9VC96	0.202	0.124	1.105E-12	2232	0.164	0.098	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
19	AFDB:Q09847	0.179	0.181	4.547E-9	1325	0.102	0.103	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
20	AFDB:Q92834	0.143	0.180	1.895E-6	1020	0.101	0.132	Q92834.pdb.gz	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K4P0	0.0	2535	1330	0.960	0.965	WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus OX=10090 GN=Wdr33 PE=1 SV=1
2	Q9C0J8	0.0	2638	1336	1.000	1.000	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
3	U4PCM1	7.49e-164	513	809	0.226	0.373	WDR33_CAEEL pre-mRNA 3' end processing protein pfs-2 OS=Caenorhabditis elegans OX=6239 GN=pfs-2 PE=1 SV=2
4	Q6NLV4	5.69e-151	473	647	0.164	0.338	FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=1
5	F4K3Y7	2.69e-145	458	657	0.164	0.333	F4K3Y7_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=2
6	Q9UTN4	2.89e-114	370	509	0.134	0.352	PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfs2 PE=4 SV=1
7	Q5JKX0	5.55e-105	345	527	0.115	0.292	Q5JKX0_ORYSJ Putative FY protein OS=Oryza sativa subsp. japonica OX=39947 GN=B1147A04.35 PE=2 SV=1
8	P42841	2.03e-82	280	465	0.109	0.314	PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFS2 PE=1 SV=1
9	Q585M8	8.20e-63	223	442	0.101	0.305	Q585M8_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.830 PE=4 SV=1
10	Q54KL5	8.59e-30	124	335	0.059	0.236	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
11	P61964	4.56e-25	110	334	0.058	0.234	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
12	P61965	4.56e-25	110	334	0.058	0.234	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
13	Q498M4	4.56e-25	110	334	0.058	0.234	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
14	Q6S7B0	5.13e-25	114	669	0.050	0.100	TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana OX=3702 GN=TAF5 PE=1 SV=1
15	Q7ZTX2	2.89e-24	107	334	0.057	0.228	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
16	Q4V8C4	3.81e-24	107	328	0.055	0.223	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
17	A5PJS1	1.77e-22	102	353	0.064	0.244	A5PJS1_BOVIN GNB5 protein OS=Bos taurus OX=9913 GN=GNB5 PE=1 SV=1
18	P62882	2.53e-22	102	353	0.064	0.244	GNB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus OX=10116 GN=Gnb5 PE=2 SV=1
19	Q91WQ5	3.06e-22	105	589	0.049	0.110	TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus OX=10090 GN=Taf5l PE=2 SV=1
20	P62881	4.65e-22	102	395	0.064	0.218	GNB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus OX=10090 GN=Gnb5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.6e-07	41.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF01391 Collagen	6.1e-06	37.2	Collagen triple helix repeat (20 copies)
3	PF08662 eIF2A	0.015	26.8	Eukaryotic translation initiation factor eIF2A
4	PF16529 Ge1_WD40	3.7	18.1	WD40 region of Ge1, enhancer of mRNA-decapping protein
5	PF20426 NBCH_WD40	36	14.7	Neurobeachin beta propeller domain
6	PF00400 WD40	2e-28	109.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000238112	0.999	Cleavage and polyadenylation specificity factor subunit 3
2	9606.ENSP00000245934	0.999	Symplekin
3	9606.ENSP00000292476	0.999	Cleavage and polyadenylation specificity factor subunit 4
4	9606.ENSP00000298875	0.999	Cleavage and polyadenylation specificity factor subunit 2
5	9606.ENSP00000336752	0.999	Pre-mRNA 3'-end-processing factor FIP1
6	9606.ENSP00000484669	0.999	Cleavage and polyadenylation specificity factor subunit 1
7	9606.ENSP00000315791	0.995	Cleavage stimulation factor subunit 3
8	9606.ENSP00000291386	0.994	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
9	9606.ENSP00000317872	0.989	E3 ubiquitin-protein ligase RBBP6
10	9606.ENSP00000296490	0.988	WD repeat-containing protein 82
11	9606.ENSP00000362063	0.977	Cleavage stimulation factor subunit 2
12	9606.ENSP00000216277	0.965	Poly(A) polymerase alpha
13	9606.ENSP00000298281	0.957	Pre-mRNA cleavage complex 2 protein Pcf11
14	9606.ENSP00000332444	0.948	Cleavage stimulation factor subunit 2 tau variant
15	9606.ENSP00000326031	0.946	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
16	9606.ENSP00000378769	0.946	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
17	9606.ENSP00000341779	0.939	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
18	9606.ENSP00000444029	0.925	Nuclear pore complex protein Nup153
19	9606.ENSP00000382779	0.922	Nucleoporin SEH1
20	9606.ENSP00000283195	0.919	E3 SUMO-protein ligase RanBP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.985	primary metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0034641	0.942	cellular nitrogen compound metabolic process
GO:0046483	0.938	heterocycle metabolic process
GO:0010467	0.930	gene expression
GO:1901360	0.878	organic cyclic compound metabolic process
GO:0065007	0.870	biological regulation
GO:0006139	0.867	nucleobase-containing compound metabolic process
GO:0050789	0.834	regulation of biological process
GO:0090304	0.815	nucleic acid metabolic process
GO:0050794	0.791	regulation of cellular process
GO:0016070	0.781	RNA metabolic process
GO:0006396	0.457	RNA processing
GO:0071840	0.445	cellular component organization or biogenesis
GO:0016071	0.434	mRNA metabolic process
GO:0019222	0.399	regulation of metabolic process
GO:0016043	0.362	cellular component organization
GO:0060255	0.349	regulation of macromolecule metabolic process
GO:0006397	0.320	mRNA processing
GO:0031323	0.302	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005737	0.747	cytoplasm
GO:0032991	0.692	protein-containing complex
GO:0005730	0.435	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]