StarFunc result for job id Q9C0J9

User Input

>input (482 residues)
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
GYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGSGGGPGGGAAAA
AAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLPFCFLSPSAAA
AYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKE
AP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0J9	0.999	0.999	2.317E-68	482	1.000	1.000	Q9C0J9.pdb.gz	BHE41_HUMAN Class E basic helix-loop-helix protein 41 OS=Homo sapiens OX=9606 GN=BHLHE41 PE=1 SV=1
2	AFDB:Q2PGD2	0.371	0.414	1.530E-31	421	0.515	0.589	Q2PGD2.pdb.gz	Q2PGD2_DANRE BHLH protein DEC2 OS=Danio rerio OX=7955 GN=bhlhb3l PE=2 SV=1
3	AFDB:O14503	0.246	0.282	7.265E-20	412	0.378	0.442	O14503.pdb.gz	BHE40_HUMAN Class E basic helix-loop-helix protein 40 OS=Homo sapiens OX=9606 GN=BHLHE40 PE=1 SV=1
4	AFDB:Q0D311	0.188	0.223	1.555E-19	403	0.361	0.432	Q0D311.pdb.gz	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
5	AFDB:A2AMT1	0.078	0.060	2.425E-3	669	0.145	0.105	A2AMT1.pdb.gz	BFSP1_MOUSE Filensin OS=Mus musculus OX=10090 GN=Bfsp1 PE=1 SV=1
6	AFDB:Q16643	0.079	0.062	6.277E-3	649	0.176	0.131	Q16643.pdb.gz	DREB_HUMAN Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4
7	AFDB:A0A0U1RRM6	0.096	0.061	2.377E-2	802	0.205	0.123	A0A0U1RRM6.pdb.gz	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1
8	AFDB:Q5F3W0	0.081	0.039	2.533E-2	1170	0.133	0.055	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
9	AFDB:O13166	0.075	0.055	3.264E-2	761	0.158	0.100	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
10	AFDB:Q04724	0.076	0.057	3.264E-2	770	0.168	0.105	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
11	PDB:7wfeBF	0.067	0.174	3.259	154	0.015	0.045	7wfeBF.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
12	PDB:7rroD1	0.066	0.070	3.700	425	0.056	0.064	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:7qooH	0.085	0.167	3.942	210	0.056	0.129	7qooH.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
14	PDB:6v8oO	0.075	0.091	4.200	384	0.025	0.031	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
15	PDB:6zydA	0.075	0.103	4.768	323	0.031	0.046	6zydA.pdb.gz
16	PDB:7ungD2	0.075	0.086	4.768	398	0.052	0.063	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:7k041	0.076	0.076	5.080	487	0.062	0.062	7k041.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
18	PDB:4gzrC	0.085	0.471	5.413	61	0.017	0.131	4gzrC.pdb.gz
19	PDB:1q6uA	0.075	0.135	5.767	213	0.046	0.103	1q6uA.pdb.gz
20	PDB:3j6bT	0.097	0.186	6.145	209	0.064	0.148	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35779	0.0	560	410	0.712	0.837	BHE41_RAT Class E basic helix-loop-helix protein 41 OS=Rattus norvegicus OX=10116 GN=Bhlhb3 PE=2 SV=2
2	Q99PV5	0.0	562	410	0.705	0.829	BHE41_MOUSE Class E basic helix-loop-helix protein 41 OS=Mus musculus OX=10090 GN=Bhlhe41 PE=1 SV=1
3	Q9C0J9	0.0	956	482	1.000	1.000	BHE41_HUMAN Class E basic helix-loop-helix protein 41 OS=Homo sapiens OX=9606 GN=BHLHE41 PE=1 SV=1
4	Q2PGD2	1.11e-142	417	421	0.477	0.546	Q2PGD2_DANRE BHLH protein DEC2 OS=Danio rerio OX=7955 GN=bhlhb3l PE=2 SV=1
5	O35185	5.15e-79	254	411	0.373	0.438	BHE40_MOUSE Class E basic helix-loop-helix protein 40 OS=Mus musculus OX=10090 GN=Bhlhe40 PE=1 SV=1
6	O35780	1.26e-78	253	411	0.378	0.443	BHE40_RAT Class E basic helix-loop-helix protein 40 OS=Rattus norvegicus OX=10116 GN=Bhlhe40 PE=1 SV=1
7	Q0D311	1.69e-74	242	403	0.351	0.419	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
8	O14503	3.33e-73	239	412	0.376	0.439	BHE40_HUMAN Class E basic helix-loop-helix protein 40 OS=Homo sapiens OX=9606 GN=BHLHE40 PE=1 SV=1
9	Q6IB83	3.33e-73	239	412	0.376	0.439	Q6IB83_HUMAN BHLHB2 protein OS=Homo sapiens OX=9606 GN=BHLHB2 PE=2 SV=1
10	Q9QUS4	4.28e-14	75.5	339	0.089	0.127	HEY2_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Mus musculus OX=10090 GN=Hey2 PE=1 SV=1
11	G3V7S6	4.36e-14	75.5	339	0.089	0.127	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
12	Q9NQ87	5.54e-14	75.1	328	0.095	0.140	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
13	Q9UBP5	5.74e-14	75.1	337	0.089	0.128	HEY2_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Homo sapiens OX=9606 GN=HEY2 PE=1 SV=1
14	Q9WV93	6.64e-14	74.3	299	0.089	0.144	HEY1_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Mus musculus OX=10090 GN=Hey1 PE=1 SV=1
15	Q9Y5J3	9.61e-14	73.9	304	0.089	0.141	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
16	A0A8I5ZYX7	9.82e-14	75.9	617	0.089	0.070	A0A8I5ZYX7_RAT Hes-related family bHLH transcription factor with YRPW motif 1 OS=Rattus norvegicus OX=10116 GN=Hey1 PE=4 SV=1
17	Q8AXV6	3.03e-13	72.8	317	0.085	0.129	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
18	Q7KM13	3.23e-13	73.6	425	0.108	0.122	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
19	Q9I9L0	3.67e-13	72.8	324	0.085	0.127	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
20	Q9I8A3	7.31e-13	71.2	294	0.089	0.146	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07527 Hairy_orange	5.7e-07	41.0	Hairy Orange
2	PF00010 HLH	2e-09	48.6	Helix-loop-helix DNA-binding domain
3	PF10188 Oscp1	6e+02	11.8	Organic solute transport protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242728

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254657	0.995	Period circadian protein homolog 2
2	9606.ENSP00000308741	0.993	Circadian locomoter output cycles protein kaput
3	9606.ENSP00000478187	0.988	Cryptochrome-2
4	9606.ENSP00000338283	0.985	Neuronal PAS domain-containing protein 2
5	9606.ENSP00000246672	0.983	Nuclear receptor subfamily 1 group D member 1
6	9606.ENSP00000384517	0.982	Aryl hydrocarbon receptor nuclear translocator-like protein 1
7	9606.ENSP00000362649	0.963	Histone deacetylase 1
8	9606.ENSP00000008527	0.958	Cryptochrome-1
9	9606.ENSP00000297689	0.953	Nuclear factor interleukin-3-regulated protein
10	9606.ENSP00000256495	0.935	Class E basic helix-loop-helix protein 40
11	9606.ENSP00000250003	0.919	Myoblast determination protein 1
12	9606.ENSP00000380044	0.908	Casein kinase I isoform epsilon
13	9606.ENSP00000324806	0.847	Glycogen synthase kinase-3 beta
14	9606.ENSP00000261523	0.831	Nuclear receptor ROR-alpha
15	9606.ENSP00000310006	0.818	Nuclear receptor subfamily 1 group D member 2
16	9606.ENSP00000364678	0.814	Histone-lysine N-methyltransferase EHMT2
17	9606.ENSP00000482093	0.810	Period circadian protein homolog 3
18	9606.ENSP00000359206	0.789	F-box/WD repeat-containing protein 1A
19	9606.ENSP00000366093	0.772	Nuclear receptor ROR-beta
20	9606.ENSP00000327025	0.763	Nuclear receptor ROR-gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	1.000	protein heterodimerization activity
GO:0043425	1.000	bHLH transcription factor binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0070888	1.000	E-box binding
GO:0042802	0.353	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009889	0.998	regulation of biosynthetic process
GO:0010468	0.998	regulation of gene expression
GO:0051252	0.997	regulation of RNA metabolic process
GO:0048523	0.995	negative regulation of cellular process
GO:0045934	0.990	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.975	regulation of DNA-templated transcription
GO:0006357	0.969	regulation of transcription by RNA polymerase II
GO:0045892	0.952	negative regulation of DNA-templated transcription
GO:0000122	0.903	negative regulation of transcription by RNA polymerase II
GO:0050896	0.518	response to stimulus
GO:0009987	0.407	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.991	protein-containing complex
GO:0005829	0.922	cytosol
GO:0005667	0.916	transcription regulator complex
GO:0016604	0.333	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]