StarFunc result for job id Q9GIP4

User Input

>input (190 residues)
MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIV
VAIMSSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM
LDVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQ
LIVHQPTQVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63016	0.681	0.263	3.750E-13	512	0.800	0.297	Q63016.pdb.gz	LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus OX=10116 GN=Slc7a5 PE=1 SV=2
2	PDB:7dskB	0.601	0.269	8.989E-11	464	0.668	0.274	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
3	PDB:6jmqA	0.600	0.299	5.745E-10	403	0.642	0.303	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
4	AFDB:D3ZMM8	0.639	0.254	2.411E-8	515	0.416	0.153	D3ZMM8.pdb.gz	YLAT2_RAT Y+L amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc7a6 PE=1 SV=1
5	AFDB:F1R8V8	0.622	0.248	3.041E-8	501	0.384	0.146	F1R8V8.pdb.gz
6	AFDB:Q92536	0.653	0.258	4.305E-8	515	0.368	0.136	Q92536.pdb.gz	YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A6 PE=1 SV=3
7	AFDB:Q9UM01	0.647	0.254	1.153E-7	511	0.411	0.153	Q9UM01.pdb.gz	YLAT1_HUMAN Y+L amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC7A7 PE=1 SV=2
8	AFDB:Q9Y1A7	0.665	0.267	1.454E-7	499	0.432	0.164	Q9Y1A7.pdb.gz	Q9Y1A7_DROME LD25378p OS=Drosophila melanogaster OX=7227 GN=mnd PE=2 SV=1
9	AFDB:Q19834	0.637	0.255	1.834E-7	493	0.368	0.142	Q19834.pdb.gz	Q19834_CAEEL Large neutral amino acids transporter small subunit 1 OS=Caenorhabditis elegans OX=6239 GN=aat-1 PE=1 SV=1
10	AFDB:O17395	0.655	0.265	5.206E-7	493	0.384	0.148	O17395.pdb.gz	O17395_CAEEL Large neutral amino acids transporter small subunit 1 OS=Caenorhabditis elegans OX=6239 GN=aat-3 PE=1 SV=2
11	AFDB:P63115	0.633	0.237	1.975E-6	530	0.332	0.119	P63115.pdb.gz	AAA1_MOUSE Asc-type amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc7a10 PE=1 SV=1
12	PDB:7ccsB	0.594	0.265	1.159E-5	454	0.411	0.172	7ccsB.pdb.gz
13	AFDB:Q57VR0	0.146	0.104	6.819E-1	334	0.211	0.120	Q57VR0.pdb.gz	Q57VR0_TRYB2 Transmembrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.730 PE=4 SV=1
14	PDB:1a9wE	0.182	0.228	1.494	145	0.095	0.124	1a9wE.pdb.gz	Crystal structure of a human embryonic haemoglobin: the carbonmonoxy form of gower II (alpha2 epsilon2) haemoglobin at 2.9 A resolution.
15	PDB:5gm6c	0.178	0.090	1.583	415	0.153	0.070	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7a23Z	0.125	0.158	3.363	140	0.095	0.129	7a23Z.pdb.gz	Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
17	PDB:7p34A	0.167	0.099	4.240	391	0.116	0.056	7p34A.pdb.gz	Molecular mechanism of SbmA, a promiscuous transporter exploited by antimicrobial peptides.
18	PDB:5sy1A	0.179	0.077	4.761	582	0.084	0.027	5sy1A.pdb.gz	Structure of the STRA6 receptor for retinol uptake.
19	PDB:6xboA	0.206	0.138	4.761	319	0.163	0.097	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
20	PDB:6jcxF	0.166	0.169	5.666	186	0.095	0.097	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96QB2	1.14e-105	314	507	0.879	0.329	Q96QB2_HUMAN Sodium-independent neutral amino acid transporter LAT1 OS=Homo sapiens OX=9606 GN=lat1 PE=3 SV=1
2	Q01650	5.49e-92	279	507	0.868	0.325	LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2
3	Q9TU26	1.71e-91	278	505	0.800	0.301	Q9TU26_BOVIN Blood-brain barrier large neutral amino acid transporter OS=Bos taurus OX=9913 GN=SLC7A5 PE=2 SV=1
4	Q63016	6.19e-89	271	512	0.779	0.289	LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus OX=10116 GN=Slc7a5 PE=1 SV=2
5	Q7YQK4	1.68e-85	262	503	0.779	0.294	LAT1_RABIT Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC7A5 PE=1 SV=1
6	Q9Z127	1.20e-84	260	512	0.711	0.264	LAT1_MOUSE Large neutral amino acids transporter small subunit 1 OS=Mus musculus OX=10090 GN=Slc7a5 PE=1 SV=2
7	D3ZMM8	1.22e-46	161	515	0.432	0.159	YLAT2_RAT Y+L amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc7a6 PE=1 SV=1
8	Q8BGK6	1.45e-46	161	515	0.426	0.157	YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc7a6 PE=1 SV=1
9	Q9Z1K8	1.51e-45	158	510	0.416	0.155	YLAT1_MOUSE Y+L amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc7a7 PE=1 SV=1
10	Q9VKC2	2.16e-45	158	500	0.411	0.156	Q9VKC2_DROME Amino acid transporter protein JHI-21 OS=Drosophila melanogaster OX=7227 GN=JhI-21 PE=1 SV=1
11	Q9Y1A7	2.48e-45	157	499	0.442	0.168	Q9Y1A7_DROME LD25378p OS=Drosophila melanogaster OX=7227 GN=mnd PE=2 SV=1
12	Q9UM01	9.21e-45	156	511	0.421	0.157	YLAT1_HUMAN Y+L amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC7A7 PE=1 SV=2
13	Q19834	1.02e-44	156	493	0.411	0.158	Q19834_CAEEL Large neutral amino acids transporter small subunit 1 OS=Caenorhabditis elegans OX=6239 GN=aat-1 PE=1 SV=1
14	Q9UHI5	1.18e-44	156	535	0.405	0.144	LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1
15	Q9WTR6	1.31e-44	156	502	0.379	0.143	XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus OX=10090 GN=Slc7a11 PE=1 SV=1
16	D4ADU2	1.89e-44	155	493	0.379	0.146	D4ADU2_RAT Solute carrier family 7 member 11 OS=Rattus norvegicus OX=10116 GN=Slc7a11 PE=1 SV=2
17	A0A8I6AB70	2.17e-44	155	502	0.379	0.143	A0A8I6AB70_RAT Solute carrier family 7 member 11 OS=Rattus norvegicus OX=10116 GN=Slc7a11 PE=3 SV=1
18	Q9QXW9	3.19e-44	155	531	0.411	0.147	LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus OX=10090 GN=Slc7a8 PE=1 SV=1
19	Q2YDQ4	2.77e-43	152	501	0.384	0.146	Q2YDQ4_DANRE Solute carrier family 7 (Cationic amino acid transporter, y+ system), member 7 OS=Danio rerio OX=7955 GN=zgc:123300 PE=2 SV=1
20	Q92536	3.60e-42	149	515	0.368	0.136	YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	4.6	17.4	Amino acid permease
2	PF13520 AA_permease_2	1.9e-11	55.1	Amino acid permease
3	PF01490 Aa_trans	71	13.6	Transmembrane amino acid transporter protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 51337.XP_004666110.1

Rank	PPI partner	STRING score	Description
1	51337.XP_004656627.1	0.999	4F2 cell-surface antigen heavy chain
2	51337.XP_004660250.1	0.803	Neutral and basic amino acid transport protein rBAT
3	51337.XP_004672694.1	0.697	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 15 Proteins
4	51337.XP_004671415.1	0.692	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
5	51337.XP_004660137.1	0.690	Neutral amino acid transporter A
6	51337.XP_004653051.1	0.688	Excitatory amino acid transporter 3
7	51337.XP_004660863.1	0.688	Excitatory amino acid transporter 2
8	51337.XP_004672803.1	0.688	Excitatory amino acid transporter 4
9	51337.XP_004654733.1	0.652	Basigin
10	51337.XP_004649511.1	0.644	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins
11	51337.XP_004659888.1	0.638	B(0,+)-type amino acid transporter 1
12	51337.XP_004655987.1	0.635	Cystine/glutamate transporter
13	51337.XP_004668596.1	0.625	Sodium-coupled neutral amino acid transporter 2
14	51337.XP_004657869.1	0.605	Equilibrative nucleoside transporter 3
15	51337.XP_004652651.1	0.584	Excitatory amino acid transporter 1-like
16	51337.XP_004673174.1	0.584	Excitatory amino acid transporter 1-like
17	51337.XP_004671538.1	0.578	Upstream in-frame stop codon
18	51337.XP_004668595.1	0.565	Sodium-coupled neutral amino acid transporter 1
19	51337.XP_004673386.1	0.559	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
20	51337.XP_004667913.1	0.550	Large neutral amino acids transporter small subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015171	1.000	amino acid transmembrane transporter activity
GO:0015179	0.988	L-amino acid transmembrane transporter activity
GO:0015175	0.813	neutral L-amino acid transmembrane transporter activity
GO:0005488	0.762	binding
GO:0005515	0.607	protein binding
GO:0015658	0.584	branched-chain amino acid transmembrane transporter activity
GO:0015173	0.576	aromatic amino acid transmembrane transporter activity
GO:0015190	0.540	L-leucine transmembrane transporter activity
GO:0022804	0.463	active transmembrane transporter activity
GO:0015297	0.428	antiporter activity
GO:0015318	0.354	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.311	monoatomic ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.986	localization
GO:0051234	0.984	establishment of localization
GO:0015849	0.965	organic acid transport
GO:0006865	0.947	amino acid transport
GO:0009987	0.428	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.988	membrane
GO:0071944	0.987	cell periphery
GO:0005886	0.975	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]