StarFunc result for job id Q9GZN1

User Input

>input (396 residues)
MTTLVLDNGAYNAKIGYSHENVSVIPNCQFRSKTARLKTFTANQIDEIKDPSGLFYILPF
QKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQFQ
AVLRVNAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLL
TNHLKEIISYRQLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEENTVMIDYVLPD
FSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIVY
SIQNLPEEMQPHFFKNIVLTGGNSLFPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAW
EGGKLISENDDFEDMVVTREDYEENGHSVCEEKFDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DEE9	0.999	0.999	6.215E-79	396	0.952	0.952	Q9DEE9.pdb.gz	ARP6_CHICK Actin-related protein 6 OS=Gallus gallus OX=9031 GN=ACTR6 PE=1 SV=1
2	PDB:6igmG	0.847	0.913	2.181E-49	366	0.917	0.992	6igmG.pdb.gz
3	AFDB:P45890	0.948	0.943	9.754E-49	398	0.465	0.462	P45890.pdb.gz	ARP6_DROME Actin-related protein 6 OS=Drosophila melanogaster OX=7227 GN=Arp6 PE=1 SV=1
4	AFDB:O94241	0.911	0.899	5.195E-45	401	0.394	0.389	O94241.pdb.gz	ARP6_SCHPO Actin-like protein arp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arp6 PE=3 SV=1
5	AFDB:Q8LGE3	0.916	0.863	3.022E-42	421	0.361	0.340	Q8LGE3.pdb.gz	ARP6_ARATH Actin-related protein 6 OS=Arabidopsis thaliana OX=3702 GN=ARP6 PE=1 SV=1
6	AFDB:Q12509	0.910	0.825	3.237E-34	438	0.288	0.260	Q12509.pdb.gz	ARP6_YEAST Actin-like protein ARP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP6 PE=1 SV=1
7	AFDB:A0A1D8PFR4	0.822	0.864	8.482E-33	376	0.260	0.274	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
8	AFDB:B6VNT8	0.837	0.877	1.648E-32	377	0.258	0.271	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
9	AFDB:P07829	0.834	0.876	2.428E-32	376	0.247	0.261	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
10	AFDB:A0A384NQ21	0.847	0.890	2.713E-32	376	0.260	0.274	A0A384NQ21.pdb.gz	A0A384NQ21_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
11	AFDB:P10989	0.835	0.879	2.713E-32	375	0.255	0.269	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
12	PDB:6gejR	0.877	0.846	6.203E-32	411	0.285	0.275	6gejR.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6tu4A	0.849	0.901	1.504E-31	372	0.268	0.285	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:1yagA	0.827	0.877	4.074E-31	372	0.268	0.285	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
15	PDB:1c0gA	0.820	0.880	1.626E-30	368	0.245	0.264	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
16	PDB:4cbxA	0.814	0.895	2.989E-30	358	0.245	0.271	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
17	PDB:4pl7A	0.797	0.825	2.647E-28	382	0.258	0.267	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
18	PDB:4a7fA	0.817	0.860	3.269E-26	375	0.270	0.285	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
19	PDB:3dwlA	0.674	0.742	8.761E-24	355	0.237	0.265	3dwlA.pdb.gz	Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
20	PDB:6w18B	0.774	0.831	2.961E-23	367	0.245	0.264	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9DEE9	0.0	795	396	0.952	0.952	ARP6_CHICK Actin-related protein 6 OS=Gallus gallus OX=9031 GN=ACTR6 PE=1 SV=1
2	Q9GZN1	0.0	823	396	1.000	1.000	ARP6_HUMAN Actin-related protein 6 OS=Homo sapiens OX=9606 GN=ACTR6 PE=1 SV=1
3	P45890	3.72e-134	391	398	0.470	0.467	ARP6_DROME Actin-related protein 6 OS=Drosophila melanogaster OX=7227 GN=Arp6 PE=1 SV=1
4	O94241	1.95e-96	295	401	0.399	0.394	ARP6_SCHPO Actin-like protein arp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arp6 PE=3 SV=1
5	Q8LGE3	1.08e-78	250	421	0.379	0.356	ARP6_ARATH Actin-related protein 6 OS=Arabidopsis thaliana OX=3702 GN=ARP6 PE=1 SV=1
6	A0A1D8PFR4	8.44e-52	179	376	0.273	0.287	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
7	P60009	1.42e-50	176	375	0.273	0.288	ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ACT1 PE=3 SV=1
8	P60010	1.42e-50	176	375	0.273	0.288	ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACT1 PE=1 SV=1
9	P53498	4.19e-49	172	377	0.275	0.289	ACT_CHLRE Actin OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
10	Q12509	4.20e-49	174	438	0.321	0.290	ARP6_YEAST Actin-like protein ARP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP6 PE=1 SV=1
11	P63259	2.59e-48	170	375	0.265	0.280	ACTG_RAT Actin, cytoplasmic 2 OS=Rattus norvegicus OX=10116 GN=Actg1 PE=1 SV=1
12	P63260	2.59e-48	170	375	0.265	0.280	ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus OX=10090 GN=Actg1 PE=1 SV=1
13	P63261	2.59e-48	170	375	0.265	0.280	ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1
14	P29751	3.45e-48	169	375	0.265	0.280	ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus OX=9986 GN=ACTB PE=2 SV=1
15	P60706	4.21e-48	169	375	0.265	0.280	ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus OX=9031 GN=ACTB PE=1 SV=1
16	P60709	4.21e-48	169	375	0.265	0.280	ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1
17	P60710	4.21e-48	169	375	0.265	0.280	ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1
18	P60711	4.21e-48	169	375	0.265	0.280	ACTB_RAT Actin, cytoplasmic 1 OS=Rattus norvegicus OX=10116 GN=Actb PE=1 SV=1
19	P60712	4.21e-48	169	375	0.265	0.280	ACTB_BOVIN Actin, cytoplasmic 1 OS=Bos taurus OX=9913 GN=ACTB PE=1 SV=1
20	Q1KLZ0	4.21e-48	169	375	0.265	0.280	Q1KLZ0_HUMAN HCG15971, isoform CRA_a OS=Homo sapiens OX=9606 GN=PS1TP5BP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	2.5e-82	288.2	Actin
2	PF06723 MreB_Mbl	7e+02	10.4	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007474

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010052	0.993	Zinc finger, HIT-type containing 1
2	61853.ENSNLEP00000019381	0.991	Snf2-related CREBBP activator protein
3	61853.ENSNLEP00000017307	0.989	RuvB-like helicase
4	61853.ENSNLEP00000005920	0.988	RuvB-like helicase
5	61853.ENSNLEP00000012347	0.985	Vacuolar protein sorting 72 homolog (S. cerevisiae)
6	61853.ENSNLEP00000016981	0.984	DNA methyltransferase 1 associated protein 1
7	61853.ENSNLEP00000010409	0.972	E1A binding protein p400
8	61853.ENSNLEP00000004637	0.966	YEATS domain containing 4
9	61853.ENSNLEP00000004902	0.948	H2A histone family, member V
10	61853.ENSNLEP00000016551	0.948	H2A histone family, member Z
11	61853.ENSNLEP00000008821	0.942	Actin-related protein 8
12	61853.ENSNLEP00000015813	0.936	Craniofacial development protein 1
13	61853.ENSNLEP00000004173	0.891	INO80 complex subunit
14	61853.ENSNLEP00000007056	0.891	Actin-like 6A
15	61853.ENSNLEP00000014469	0.890	Actin-like 6B
16	61853.ENSNLEP00000007798	0.866	ARP5 actin-related protein 5 homolog (yeast)
17	61853.ENSNLEP00000007350	0.857	YEATS domain containing 2
18	61853.ENSNLEP00000019268	0.857	MLLT1, super elongation complex subunit
19	61853.ENSNLEP00000021267	0.857	MLLT3, super elongation complex subunit
20	61853.ENSNLEP00000007604	0.842	INO80 complex subunit C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0016043	0.980	cellular component organization
GO:0050789	0.917	regulation of biological process
GO:0050794	0.912	regulation of cellular process
GO:0019222	0.897	regulation of metabolic process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0051171	0.858	regulation of nitrogen compound metabolic process
GO:0080090	0.806	regulation of primary metabolic process
GO:0031323	0.806	regulation of cellular metabolic process
GO:0048518	0.804	positive regulation of biological process
GO:0048522	0.770	positive regulation of cellular process
GO:0009893	0.764	positive regulation of metabolic process
GO:0019219	0.762	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.746	positive regulation of macromolecule metabolic process
GO:0006997	0.693	nucleus organization
GO:0051173	0.672	positive regulation of nitrogen compound metabolic process
GO:0031325	0.662	positive regulation of cellular metabolic process
GO:0007000	0.660	nucleolus organization
GO:0010468	0.657	regulation of gene expression
GO:0010556	0.600	regulation of macromolecule biosynthetic process
GO:0045935	0.574	positive regulation of nucleobase-containing compound metabolic process
GO:0031326	0.568	regulation of cellular biosynthetic process
GO:0051252	0.567	regulation of RNA metabolic process
GO:0006355	0.553	regulation of DNA-templated transcription
GO:0010557	0.505	positive regulation of macromolecule biosynthetic process
GO:0031328	0.505	positive regulation of cellular biosynthetic process
GO:0006325	0.370	chromatin organization
GO:0045893	0.344	positive regulation of DNA-templated transcription
GO:0048519	0.341	negative regulation of biological process
GO:0048523	0.324	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0031981	0.998	nuclear lumen
GO:0005654	0.946	nucleoplasm
GO:0032991	0.888	protein-containing complex
GO:0005694	0.716	chromosome
GO:0000785	0.576	chromatin
GO:0000228	0.489	nuclear chromosome
GO:0005737	0.482	cytoplasm
GO:0005730	0.372	nucleolus
GO:1902494	0.334	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]