StarFunc result for job id Q9GZN2

User Input

>input (237 residues)
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNL
SVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPA
PTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
NTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0Y1	0.379	0.379	3.713E-29	237	0.937	0.937	Q8C0Y1.pdb.gz	TGIF2_MOUSE Homeobox protein TGIF2 OS=Mus musculus OX=10090 GN=Tgif2 PE=2 SV=1
2	AFDB:Q5BJZ9	0.362	0.302	7.481E-17	287	0.502	0.415	Q5BJZ9.pdb.gz	Q5BJZ9_RAT TGFB-induced factor homeobox 1 OS=Rattus norvegicus OX=10116 GN=Tgif1 PE=2 SV=1
3	AFDB:Q803F0	0.380	0.332	2.455E-16	273	0.532	0.462	Q803F0.pdb.gz	Q803F0_DANRE Homeobox protein TGIF1 OS=Danio rerio OX=7955 GN=TGIF PE=2 SV=1
4	AFDB:Q15583	0.336	0.203	1.934E-15	401	0.523	0.309	Q15583.pdb.gz	TGIF1_HUMAN Homeobox protein TGIF1 OS=Homo sapiens OX=9606 GN=TGIF1 PE=1 SV=3
5	AFDB:Q7JR08	0.355	0.202	1.307E-11	426	0.325	0.181	Q7JR08.pdb.gz	Q7JR08_DROME Achintya, isoform A OS=Drosophila melanogaster OX=7227 GN=achi PE=2 SV=1
6	AFDB:Q8IUE1	0.301	0.296	1.787E-11	241	0.409	0.402	Q8IUE1.pdb.gz	TF2LX_HUMAN Homeobox protein TGIF2LX OS=Homo sapiens OX=9606 GN=TGIF2LX PE=1 SV=1
7	AFDB:A1Z916	0.335	0.149	5.233E-10	555	0.295	0.126	A1Z916.pdb.gz	A1Z916_DROME Achintya, isoform C OS=Drosophila melanogaster OX=7227 GN=achi PE=4 SV=1
8	AFDB:A1Z913	0.343	0.160	2.528E-8	524	0.354	0.160	A1Z913.pdb.gz	A1Z913_DROME Vismay, isoform B OS=Drosophila melanogaster OX=7227 GN=vis PE=4 SV=1
9	AFDB:Q90ZE3	0.259	0.152	2.283E-6	415	0.194	0.111	Q90ZE3.pdb.gz	Q90ZE3_DANRE Homeobox protein Meis3 OS=Danio rerio OX=7955 GN=NH10 PE=2 SV=1
10	AFDB:O14770	0.261	0.137	3.765E-6	477	0.207	0.103	O14770.pdb.gz	MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2
11	PDB:4egcA	0.186	0.083	7.032E-3	539	0.084	0.037	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.206	0.533	1.102E-1	73	0.051	0.164	2hi3A.pdb.gz
13	PDB:3m8eA	0.091	0.173	1.263	101	0.038	0.089	3m8eA.pdb.gz
14	PDB:5nr5A	0.158	0.306	1.263	113	0.042	0.088	5nr5A.pdb.gz
15	PDB:7q4pC	0.118	0.044	1.345	878	0.038	0.010	7q4pC.pdb.gz	Structural basis of branch site recognition by the human spliceosome.
16	PDB:3femA	0.125	0.109	1.432	281	0.042	0.036	3femA.pdb.gz
17	PDB:2vbwA	0.173	0.269	1.957	147	0.038	0.061	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
18	PDB:3axjB	0.106	0.104	1.957	240	0.063	0.062	3axjB.pdb.gz
19	PDB:5iplF	0.095	0.084	2.218	277	0.063	0.054	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
20	PDB:2gqqC	0.167	0.242	2.361	157	0.034	0.051	2gqqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZN2	5.51e-173	477	237	1.000	1.000	TGIF2_HUMAN Homeobox protein TGIF2 OS=Homo sapiens OX=9606 GN=TGIF2 PE=1 SV=1
2	Q8C0Y1	1.89e-162	450	237	0.937	0.937	TGIF2_MOUSE Homeobox protein TGIF2 OS=Mus musculus OX=10090 GN=Tgif2 PE=2 SV=1
3	H0YKN5	1.89e-124	352	174	0.734	1.000	H0YKN5_HUMAN TGFB induced factor homeobox 2 (Fragment) OS=Homo sapiens OX=9606 GN=TGIF2 PE=1 SV=1
4	Q90655	1.94e-64	203	269	0.527	0.465	AKR_CHICK Homeobox protein AKR OS=Gallus gallus OX=9031 PE=2 SV=1
5	P70284	3.98e-64	202	272	0.536	0.467	TGIF1_MOUSE Homeobox protein TGIF1 OS=Mus musculus OX=10090 GN=Tgif1 PE=1 SV=2
6	F8VVS9	3.02e-62	196	245	0.519	0.502	F8VVS9_HUMAN TGFB induced factor homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=TGIF1 PE=1 SV=8
7	Q15583	2.41e-61	199	401	0.549	0.324	TGIF1_HUMAN Homeobox protein TGIF1 OS=Homo sapiens OX=9606 GN=TGIF1 PE=1 SV=3
8	Q803F0	2.90e-57	185	273	0.532	0.462	Q803F0_DANRE Homeobox protein TGIF1 OS=Danio rerio OX=7955 GN=TGIF PE=2 SV=1
9	A0A8I6ACG1	1.01e-54	178	273	0.485	0.421	A0A8I6ACG1_RAT TGFB-induced factor homeobox 1 OS=Rattus norvegicus OX=10116 GN=Tgif1 PE=4 SV=1
10	A0A8I6GEN1	1.20e-54	178	272	0.485	0.423	A0A8I6GEN1_RAT TGFB-induced factor homeobox 1 OS=Rattus norvegicus OX=10116 GN=Tgif1 PE=4 SV=1
11	A0A8I5ZTL5	2.92e-54	177	295	0.485	0.390	A0A8I5ZTL5_RAT TGFB-induced factor homeobox 1 OS=Rattus norvegicus OX=10116 GN=Tgif1 PE=4 SV=1
12	Q5BJZ9	2.94e-54	177	287	0.485	0.401	Q5BJZ9_RAT TGFB-induced factor homeobox 1 OS=Rattus norvegicus OX=10116 GN=Tgif1 PE=2 SV=1
13	F8VUY0	9.91e-51	166	219	0.392	0.425	F8VUY0_HUMAN TGFB induced factor homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=TGIF1 PE=1 SV=1
14	Q8IUE1	3.92e-47	158	241	0.392	0.386	TF2LX_HUMAN Homeobox protein TGIF2LX OS=Homo sapiens OX=9606 GN=TGIF2LX PE=1 SV=1
15	Q7K380	6.41e-40	144	424	0.274	0.153	Q7K380_DROME SD01238p OS=Drosophila melanogaster OX=7227 GN=vis PE=2 SV=1
16	Q7JR08	8.52e-40	143	426	0.274	0.153	Q7JR08_DROME Achintya, isoform A OS=Drosophila melanogaster OX=7227 GN=achi PE=2 SV=1
17	A1Z916	7.85e-39	143	555	0.274	0.117	A1Z916_DROME Achintya, isoform C OS=Drosophila melanogaster OX=7227 GN=achi PE=4 SV=1
18	A1Z913	1.12e-37	139	524	0.249	0.113	A1Z913_DROME Vismay, isoform B OS=Drosophila melanogaster OX=7227 GN=vis PE=4 SV=1
19	Q8IUE0	4.31e-32	117	185	0.249	0.319	TF2LY_HUMAN Homeobox protein TGIF2LY OS=Homo sapiens OX=9606 GN=TGIF2LY PE=1 SV=1
20	Q96KN3	5.56e-18	84.3	472	0.148	0.074	PKNX2_HUMAN Homeobox protein PKNOX2 OS=Homo sapiens OX=9606 GN=PKNOX2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	1.6e-13	61.6	Homeobox KN domain
2	PF00046 Homeodomain	0.0033	28.5	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362981

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332973	0.940	Mothers against decapentaplegic homolog 3
2	9606.ENSP00000341551	0.929	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000223095	0.900	Plasminogen activator inhibitor 1
4	9606.ENSP00000320171	0.898	Pyruvate kinase PKM
5	9606.ENSP00000262160	0.862	Mothers against decapentaplegic homolog 2
6	9606.ENSP00000416330	0.830	Transforming growth factor-beta-induced protein ig-h3
7	9606.ENSP00000308012	0.818	Polyadenylate-binding protein 5
8	9606.ENSP00000327959	0.818	Homeobox protein TGIF1
9	9606.ENSP00000362649	0.734	Histone deacetylase 1
10	9606.ENSP00000361373	0.637	Krueppel-like factor 17
11	9606.ENSP00000357556	0.623	Homeobox protein VENTX
12	9606.ENSP00000362186	0.604	Protocadherin-11 X-linked
13	9606.ENSP00000363689	0.569	DNA-binding protein inhibitor ID-3
14	9606.ENSP00000341108	0.539	Homeobox protein HMX2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0140110	0.953	transcription regulator activity
GO:0000976	0.942	transcription cis-regulatory region binding
GO:0003700	0.930	DNA-binding transcription factor activity
GO:0000977	0.802	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.638	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.331	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0010605	0.977	negative regulation of macromolecule metabolic process
GO:0051172	0.960	negative regulation of nitrogen compound metabolic process
GO:0048523	0.959	negative regulation of cellular process
GO:0006357	0.954	regulation of transcription by RNA polymerase II
GO:0045892	0.929	negative regulation of DNA-templated transcription
GO:0009987	0.878	cellular process
GO:0032502	0.838	developmental process
GO:0000122	0.806	negative regulation of transcription by RNA polymerase II
GO:0032501	0.804	multicellular organismal process
GO:0048518	0.787	positive regulation of biological process
GO:0048856	0.774	anatomical structure development
GO:0048522	0.623	positive regulation of cellular process
GO:0007275	0.576	multicellular organism development
GO:0050896	0.514	response to stimulus
GO:0048513	0.489	animal organ development
GO:0051239	0.479	regulation of multicellular organismal process
GO:0009893	0.438	positive regulation of metabolic process
GO:0051716	0.412	cellular response to stimulus
GO:0010604	0.404	positive regulation of macromolecule metabolic process
GO:0007178	0.339	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051173	0.309	positive regulation of nitrogen compound metabolic process
GO:0050793	0.307	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005737	0.683	cytoplasm
GO:0005856	0.608	cytoskeleton
GO:0015630	0.433	microtubule cytoskeleton
GO:0032991	0.428	protein-containing complex
GO:0005815	0.415	microtubule organizing center
GO:0005813	0.368	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]