StarFunc result for job id Q9GZN6

User Input

>input (736 residues)
MKTEAQPSTSLLANTSWTGTVISDSVPGSQTWEDKGSLTRSATSWTSEAQVSAARVAEAQ
ARTSQPKQISVLEALTASALNQKPTHEKVQMTEKKESEVLLARPFWSSKTEYILAQVGFS
MKPSCLWRFAYLWLNSGGCSFAAIYIFMLFLVGVPLLFLEMAAGQSMRQGGMGVWKIIAP
WIGGVGYSSFMVCFILGLYFNVVNSWIIFYMSQSFQFPVPWEKCPLTMNSSGFDPECERT
TPSIYFWYQQALKASDRIEDGGSPVYSLVLPFFLCWCLVGAFMINGLKSTGKVIYVLVLL
PCFIIVGFFIRTLLLEGAKFGLQQLVVAKISDVYNMSVWSLAGGQVLSNTGIGLGSVASL
ASYMPQSNNCLSDAFLVSVINLLTLLVFTSFNFCVLGFWATVITHRCCERNAEILLKLIN
LGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFA
FLSFVEAMSFLPPSVFWSFIFFLMLLAMGLSSAIGIMQGIITPLQDTFSFFRKHTKLLIV
GVFLLMFVCGLFFTRPSGSYFIRLLSDYWIVFPIIVVVVFETMAVSWAYGARRFLADLTI
LLGHPISPIFGWLWPHLCPVVLLIIFVTMMVHLCMKPITYMSWDSSTSKEVLRPYPPWAL
LLMITLFAIVILPIPAYFVYCRIHRIPFRPKSGDGPMTASTSLPLSHQLTPSKEVQKEEI
LQVDETKYPSTCNVTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31662	0.759	0.768	5.105E-42	727	0.310	0.314	P31662.pdb.gz	S6A17_RAT Sodium-dependent neutral amino acid transporter SLC6A17 OS=Rattus norvegicus OX=10116 GN=Slc6a17 PE=1 SV=1
2	AFDB:Q9H2J7	0.757	0.763	1.995E-41	730	0.307	0.310	Q9H2J7.pdb.gz	S6A15_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1
3	AFDB:O88575	0.742	0.856	1.063E-38	635	0.270	0.313	O88575.pdb.gz	S620B_MOUSE Sodium- and chloride-dependent transporter XTRP3B OS=Mus musculus OX=10090 GN=Slc6a20b PE=1 SV=3
4	AFDB:Q64093	0.752	0.893	1.063E-38	616	0.262	0.313	Q64093.pdb.gz	S6A20_RAT Sodium- and chloride-dependent transporter XTRP3 OS=Rattus norvegicus OX=10116 GN=Slc6a20 PE=2 SV=1
5	AFDB:F6SPX0	0.757	0.844	2.235E-38	657	0.272	0.304	F6SPX0.pdb.gz	F6SPX0_MONDO Transporter OS=Monodelphis domestica OX=13616 GN=SLC6A20 PE=3 SV=3
6	AFDB:Q2A865	0.739	0.853	7.715E-38	634	0.279	0.323	Q2A865.pdb.gz	S6A19_RAT Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Rattus norvegicus OX=10116 GN=Slc6a19 PE=1 SV=2
7	AFDB:B5X4N9	0.747	0.861	8.041E-38	635	0.265	0.307	B5X4N9.pdb.gz	B5X4N9_SALSA Transporter OS=Salmo salar OX=8030 GN=S6A19 PE=2 SV=1
8	AFDB:Q695T7	0.739	0.853	8.380E-38	634	0.277	0.322	Q695T7.pdb.gz	S6A19_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Homo sapiens OX=9606 GN=SLC6A19 PE=1 SV=1
9	AFDB:R4N225	0.747	0.863	3.142E-37	634	0.264	0.306	R4N225.pdb.gz	R4N225_DICLA Transporter OS=Dicentrarchus labrax OX=13489 GN=SLC6A19 PE=2 SV=1
10	AFDB:O88576	0.738	0.878	5.431E-36	615	0.258	0.309	O88576.pdb.gz	S6A18_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Mus musculus OX=10090 GN=Slc6a18 PE=1 SV=1
11	PDB:7dwxA	0.717	0.866	1.347E-33	605	0.270	0.329	7dwxA.pdb.gz	Structural basis for the different states of the spike protein of SARS-CoV-2 in complex with ACE2.
12	PDB:6vrhA	0.647	0.872	5.600E-27	541	0.200	0.272	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.
13	PDB:7sk2A	0.596	0.806	1.524E-21	532	0.204	0.282	7sk2A.pdb.gz	Structural basis of GABA reuptake inhibition.
14	PDB:7s1xB	0.416	0.360	1.279E-6	871	0.099	0.084	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
15	PDB:5j4nA	0.381	0.586	6.952E-6	437	0.107	0.181	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
16	PDB:7dskB	0.302	0.444	1.141E-5	464	0.099	0.157	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
17	PDB:7cmhB	0.327	0.471	1.252E-4	458	0.098	0.157	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
18	PDB:4djiA	0.343	0.462	2.425E-4	493	0.090	0.134	4djiA.pdb.gz
19	PDB:7p9uB	0.320	0.468	2.527E-4	455	0.076	0.123	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
20	PDB:7d10A	0.327	0.481	3.517E-4	446	0.082	0.135	7d10A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BG16	3.88e-145	444	729	0.317	0.320	S6A15_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Mus musculus OX=10090 GN=Slc6a15 PE=1 SV=1
2	Q9H1V8	1.12e-144	442	727	0.333	0.337	S6A17_HUMAN Sodium-dependent neutral amino acid transporter SLC6A17 OS=Homo sapiens OX=9606 GN=SLC6A17 PE=1 SV=3
3	Q8BJI1	1.77e-144	442	727	0.321	0.325	S6A17_MOUSE Sodium-dependent neutral amino acid transporter SLC6A17 OS=Mus musculus OX=10090 GN=Slc6a17 PE=1 SV=1
4	P31662	2.19e-144	441	727	0.317	0.320	S6A17_RAT Sodium-dependent neutral amino acid transporter SLC6A17 OS=Rattus norvegicus OX=10116 GN=Slc6a17 PE=1 SV=1
5	Q9H2J7	1.27e-141	434	730	0.311	0.314	S6A15_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1
6	Q2A865	8.11e-112	354	634	0.280	0.325	S6A19_RAT Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Rattus norvegicus OX=10116 GN=Slc6a19 PE=1 SV=2
7	Q9D687	1.00e-110	351	634	0.277	0.322	S6A19_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Mus musculus OX=10090 GN=Slc6a19 PE=1 SV=1
8	B5X4N9	1.40e-110	351	635	0.280	0.324	B5X4N9_SALSA Transporter OS=Salmo salar OX=8030 GN=S6A19 PE=2 SV=1
9	R4N225	2.13e-110	350	634	0.273	0.317	R4N225_DICLA Transporter OS=Dicentrarchus labrax OX=13489 GN=SLC6A19 PE=2 SV=1
10	F6SPX0	1.33e-109	349	657	0.268	0.300	F6SPX0_MONDO Transporter OS=Monodelphis domestica OX=13616 GN=SLC6A20 PE=3 SV=3
11	O88575	2.25e-108	345	635	0.264	0.306	S620B_MOUSE Sodium- and chloride-dependent transporter XTRP3B OS=Mus musculus OX=10090 GN=Slc6a20b PE=1 SV=3
12	Q695T7	7.51e-107	341	634	0.277	0.322	S6A19_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Homo sapiens OX=9606 GN=SLC6A19 PE=1 SV=1
13	Q64093	1.71e-106	339	616	0.270	0.323	S6A20_RAT Sodium- and chloride-dependent transporter XTRP3 OS=Rattus norvegicus OX=10116 GN=Slc6a20 PE=2 SV=1
14	Q9NP91	4.77e-106	338	592	0.273	0.340	S6A20_HUMAN Sodium- and chloride-dependent transporter XTRP3 OS=Homo sapiens OX=9606 GN=SLC6A20 PE=1 SV=1
15	Q8VDB9	1.14e-102	329	592	0.266	0.331	S620A_MOUSE Sodium- and chloride-dependent transporter XTRP3A OS=Mus musculus OX=10090 GN=Slc6a20a PE=1 SV=1
16	O88576	2.87e-101	326	615	0.265	0.317	S6A18_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Mus musculus OX=10090 GN=Slc6a18 PE=1 SV=1
17	Q62687	6.31e-100	322	615	0.261	0.312	S6A18_RAT Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Rattus norvegicus OX=10116 GN=Slc6a18 PE=2 SV=1
18	Q96N87	6.21e-92	301	628	0.260	0.304	S6A18_HUMAN Inactive sodium-dependent neutral amino acid transporter B(0)AT3 OS=Homo sapiens OX=9606 GN=SLC6A18 PE=2 SV=2
19	P23975	4.94e-67	234	617	0.240	0.287	SC6A2_HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens OX=9606 GN=SLC6A2 PE=1 SV=1
20	O55192	4.16e-66	232	617	0.240	0.287	SC6A2_MOUSE Sodium-dependent noradrenaline transporter OS=Mus musculus OX=10090 GN=Slc6a2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04842 DUF639	33	15.4	Plant protein of unknown function (DUF639)
2	PF00209 SNF	4.1e-117	403.7	Sodium:neurotransmitter symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338627

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334223	0.726	Proton-coupled amino acid transporter 2
2	9606.ENSP00000478639	0.555	Amino acid transporter
3	9606.ENSP00000248306	0.523	Methyltransferase-like protein 25
4	9606.ENSP00000339626	0.514	Solute carrier family 35 member E4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015370	0.999	solute:sodium symporter activity
GO:0005515	0.998	protein binding
GO:0046943	0.997	carboxylic acid transmembrane transporter activity
GO:0015171	0.994	amino acid transmembrane transporter activity
GO:0005416	0.847	amino acid:monoatomic cation symporter activity
GO:0005343	0.820	organic acid:sodium symporter activity
GO:0015378	0.805	sodium:chloride symporter activity
GO:0005283	0.801	amino acid:sodium symporter activity
GO:0015175	0.643	neutral L-amino acid transmembrane transporter activity
GO:0015179	0.521	L-amino acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.984	transport
GO:0071702	0.885	organic substance transport
GO:0009987	0.734	cellular process
GO:0065007	0.545	biological regulation
GO:0071705	0.531	nitrogen compound transport
GO:0050789	0.440	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.749	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)
RHEA:29823	0.805	chloride(in) = chloride(out)

[back to server]