StarFunc result for job id Q9GZN8

User Input

>input (174 residues)
MAAANKGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKI
LHRYEITFTLPPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEI
LLACEGGTGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZN8	1.000	1.000	9.179E-34	174	1.000	1.000	Q9GZN8.pdb.gz	ADSSP_HUMAN Adipose-secreted signaling protein OS=Homo sapiens OX=9606 GN=ADISSP PE=1 SV=3
2	AFDB:Q9VSK4	0.685	0.664	2.113E-13	180	0.310	0.300	Q9VSK4.pdb.gz	Q9VSK4_DROME Adipose-secreted signaling protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6983 PE=1 SV=1
3	AFDB:Q385G3	0.391	0.052	5.874E-5	1707	0.138	0.014	Q385G3.pdb.gz	Q385G3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3880 PE=4 SV=1
4	AFDB:A2VDJ0	0.352	0.050	1.597E-4	1609	0.132	0.014	A2VDJ0.pdb.gz	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
5	AFDB:Q1JQ46	0.340	0.121	2.356E-4	573	0.098	0.030	Q1JQ46.pdb.gz
6	AFDB:O18738	0.279	0.076	6.403E-4	895	0.155	0.030	O18738.pdb.gz	DAG1_BOVIN Dystroglycan 1 OS=Bos taurus OX=9913 GN=DAG1 PE=1 SV=1
7	AFDB:P91870	0.388	0.098	8.935E-4	824	0.086	0.018	P91870.pdb.gz	SPD2_CAEEL Spindle-defective protein 2 OS=Caenorhabditis elegans OX=6239 GN=spd-2 PE=1 SV=1
8	AFDB:Q69CM7	0.300	0.071	9.985E-4	928	0.092	0.017	Q69CM7.pdb.gz	MYBPP_RAT MYCBP-associated protein OS=Rattus norvegicus OX=10116 GN=Mycbpap PE=1 SV=1
9	AFDB:Q57YP6	0.239	0.320	1.180E-3	121	0.057	0.083	Q57YP6.pdb.gz	Q57YP6_TRYB2 Inhibitor of cysteine peptidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.50 PE=4 SV=1
10	AFDB:A9Q751	0.389	0.101	1.318E-3	836	0.115	0.024	A9Q751.pdb.gz	PCDP1_MOUSE Cilia- and flagella-associated protein 221 OS=Mus musculus OX=10090 GN=Cfap221 PE=1 SV=1
11	PDB:6cjzA	0.326	0.469	1.838E-3	105	0.057	0.095	6cjzA.pdb.gz
12	PDB:4lk4A	0.301	0.184	4.230E-3	326	0.103	0.055	4lk4A.pdb.gz
13	PDB:3zmrA	0.278	0.120	7.793E-3	469	0.057	0.021	3zmrA.pdb.gz	A Discrete Genetic Locus Confers Xyloglucan Metabolism in Select Human Gut Bacteroidetes
14	PDB:4edqA	0.288	0.128	1.358E-2	483	0.069	0.025	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
15	PDB:7sqcO0	0.392	0.074	1.358E-2	1140	0.063	0.010	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:2yxvA	0.218	0.110	1.793E-2	444	0.086	0.034	2yxvA.pdb.gz	Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site
17	PDB:6p3eA	0.234	0.181	2.004E-2	246	0.092	0.065	6p3eA.pdb.gz
18	PDB:6wskA	0.280	0.190	2.004E-2	287	0.069	0.042	6wskA.pdb.gz
19	PDB:5lwxA	0.237	0.105	2.502E-2	554	0.075	0.023	5lwxA.pdb.gz	Structure and function of Aspergillus niger laccase McoG
20	PDB:3qqxA	0.242	0.113	2.796E-2	474	0.075	0.027	3qqxA.pdb.gz	CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZN8	1.62e-127	357	174	1.000	1.000	ADSSP_HUMAN Adipose-secreted signaling protein OS=Homo sapiens OX=9606 GN=ADISSP PE=1 SV=3
2	Q9VSK4	6.29e-17	76.3	180	0.293	0.283	Q9VSK4_DROME Adipose-secreted signaling protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6983 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15006 DUF4517	4e-50	181.3	Domain of unknown function (DUF4517)
2	PF02081 TrpBP	1.5e+02	13.6	Tryptophan RNA-binding attenuator protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010377260.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010377897.1	0.795	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	61622.XP_010375863.1	0.701	Dystrophia myotonica WD repeat-containing protein
3	61622.XP_010364783.1	0.682	Belongs to the PPP phosphatase family.
4	61622.XP_010384137.1	0.634	Proteasome activator subunit 3
5	61622.XP_010387455.1	0.584	RNA binding protein fox-1 homolog 2 isoform X1
6	61622.XP_010351884.1	0.527	Protein phosphatase 1 regulatory subunit 13B
7	61622.XP_010375304.1	0.527	Protein phosphatase 1 regulatory subunit 7
8	61622.XP_010378666.1	0.527	Nuclear inhibitor of protein phosphatase 1 isoform X1
9	61622.XP_010378934.1	0.527	WD repeat-containing protein 92
10	61622.XP_010371396.1	0.526	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
11	61622.XP_010352428.1	0.523	RNA polymerase II-associated protein 3 isoform X1
12	61622.XP_010363327.1	0.522	WD repeat domain 82

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008157	1.000	protein phosphatase 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:1901222	0.698	regulation of NIK/NF-kappaB signaling
GO:0090092	0.695	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090287	0.692	regulation of cellular response to growth factor stimulus
GO:0009967	0.672	positive regulation of signal transduction
GO:1903844	0.585	regulation of cellular response to transforming growth factor beta stimulus
GO:1901224	0.585	positive regulation of NIK/NF-kappaB signaling
GO:0017015	0.543	regulation of transforming growth factor beta receptor signaling pathway
GO:0090100	0.543	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009987	0.432	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.997	intracellular organelle
GO:0005634	0.991	nucleus
GO:0005654	0.983	nucleoplasm
GO:0005829	0.981	cytosol
GO:0043232	0.755	intracellular non-membrane-bounded organelle
GO:0032991	0.534	protein-containing complex
GO:0016020	0.423	membrane
GO:0005856	0.392	cytoskeleton
GO:0071944	0.365	cell periphery
GO:0005886	0.361	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]