StarFunc result for job id Q9GZP0

User Input

>input (370 residues)
MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZP0	1.000	1.000	4.520E-70	370	1.000	1.000	Q9GZP0.pdb.gz	PDGFD_HUMAN Platelet-derived growth factor D OS=Homo sapiens OX=9606 GN=PDGFD PE=1 SV=1
2	AFDB:Q925I7	0.360	0.360	4.218E-58	370	0.851	0.851	Q925I7.pdb.gz	PDGFD_MOUSE Platelet-derived growth factor D OS=Mus musculus OX=10090 GN=Pdgfd PE=2 SV=1
3	AFDB:Q9NRA1	0.319	0.341	6.127E-36	345	0.403	0.432	Q9NRA1.pdb.gz	PDGFC_HUMAN Platelet-derived growth factor C OS=Homo sapiens OX=9606 GN=PDGFC PE=1 SV=2
4	AFDB:Q8CI19	0.323	0.345	1.549E-35	345	0.395	0.423	Q8CI19.pdb.gz	PDGFC_MOUSE Platelet-derived growth factor C OS=Mus musculus OX=10090 GN=Pdgfc PE=1 SV=2
5	AFDB:Q15113	0.298	0.248	1.277E-11	449	0.127	0.105	Q15113.pdb.gz	PCOC1_HUMAN Procollagen C-endopeptidase enhancer 1 OS=Homo sapiens OX=9606 GN=PCOLCE PE=1 SV=2
6	AFDB:Q61398	0.291	0.232	1.505E-11	468	0.130	0.103	Q61398.pdb.gz	PCOC1_MOUSE Procollagen C-endopeptidase enhancer 1 OS=Mus musculus OX=10090 GN=Pcolce PE=1 SV=2
7	AFDB:B0BN34	0.300	0.399	2.743E-11	275	0.111	0.149	B0BN34.pdb.gz	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
8	AFDB:A3KNA2	0.292	0.114	4.244E-11	959	0.108	0.042	A3KNA2.pdb.gz
9	AFDB:O14786	0.292	0.119	5.576E-11	923	0.111	0.044	O14786.pdb.gz	NRP1_HUMAN Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3
10	AFDB:B3DFP6	0.305	0.126	5.889E-11	927	0.114	0.045	B3DFP6.pdb.gz
11	PDB:1wq8A	0.230	0.781	4.200E-6	100	0.057	0.210	1wq8A.pdb.gz
12	PDB:3am2A	0.207	0.256	3.727E-5	286	0.035	0.045	3am2A.pdb.gz
13	PDB:5vqfB	0.141	0.158	1.238E-4	320	0.100	0.116	5vqfB.pdb.gz
14	PDB:5ffoG	0.145	0.174	1.308E-4	297	0.086	0.108	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
15	PDB:4qhuC	0.152	0.379	9.852E-4	119	0.054	0.168	4qhuC.pdb.gz
16	PDB:1m4uA	0.165	0.273	1.610E-3	199	0.076	0.141	1m4uA.pdb.gz
17	PDB:4dxzA	0.190	0.493	1.610E-3	111	0.011	0.036	4dxzA.pdb.gz
18	PDB:7b01A	0.210	0.140	3.100E-3	588	0.043	0.027	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
19	PDB:6hgoC	0.148	0.318	1.509E-2	127	0.041	0.118	6hgoC.pdb.gz
20	PDB:5hlyA	0.140	0.166	1.877E-2	299	0.078	0.097	5hlyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q925I7	0.0	650	370	0.851	0.851	PDGFD_MOUSE Platelet-derived growth factor D OS=Mus musculus OX=10090 GN=Pdgfd PE=2 SV=1
2	Q9EQT1	0.0	691	370	0.868	0.868	PDGFD_RAT Platelet-derived growth factor D OS=Rattus norvegicus OX=10116 GN=Pdgfd PE=2 SV=1
3	Q9GZP0	0.0	773	370	1.000	1.000	PDGFD_HUMAN Platelet-derived growth factor D OS=Homo sapiens OX=9606 GN=PDGFD PE=1 SV=1
4	Q8CI19	1.12e-93	285	345	0.400	0.429	PDGFC_MOUSE Platelet-derived growth factor C OS=Mus musculus OX=10090 GN=Pdgfc PE=1 SV=2
5	Q9NRA1	3.99e-93	284	345	0.430	0.461	PDGFC_HUMAN Platelet-derived growth factor C OS=Homo sapiens OX=9606 GN=PDGFC PE=1 SV=2
6	F1REM3	4.11e-14	76.3	976	0.119	0.045	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
7	P98070	4.55e-14	75.9	707	0.116	0.061	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
8	P13497	6.60e-14	75.5	986	0.116	0.044	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
9	F1M798	7.10e-14	75.5	990	0.116	0.043	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
10	P98063	7.77e-14	75.5	991	0.116	0.043	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
11	Q9Y6L7	1.73e-13	74.3	1015	0.116	0.042	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
12	Q9WVM6	4.86e-13	72.8	1012	0.108	0.040	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
13	O57460	5.53e-13	72.8	1022	0.105	0.038	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
14	Q8JI28	6.70e-13	72.4	1007	0.111	0.041	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
15	Q6T870	1.35e-12	71.6	959	0.119	0.046	Q6T870_DANRE Neuropilin OS=Danio rerio OX=7955 GN=nrp1b PE=2 SV=1
16	O43897	6.90e-12	69.3	1013	0.103	0.038	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
17	P25723	1.71e-11	68.2	1067	0.103	0.036	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
18	Q2ABP1	1.78e-11	68.2	986	0.119	0.045	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
19	Q62381	4.79e-11	66.6	1013	0.095	0.035	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
20	Q9TU53	5.66e-11	66.6	3620	0.114	0.012	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	5.3e-18	76.7	CUB domain
2	PF00341 PDGF	8.2e-15	66.2	PDGF/VEGF domain
3	PF09180 ProRS-C_1	3.9e+02	12.7	Prolyl-tRNA synthetase, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376865

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261799	0.995	Platelet-derived growth factor receptor beta
2	9606.ENSP00000346508	0.978	Platelet-derived growth factor subunit A
3	9606.ENSP00000330382	0.965	Platelet-derived growth factor subunit B
4	9606.ENSP00000257290	0.960	Platelet-derived growth factor receptor alpha
5	9606.ENSP00000308938	0.929	Plasminogen
6	9606.ENSP00000220809	0.919	Tissue-type plasminogen activator
7	9606.ENSP00000361850	0.917	Urokinase-type plasminogen activator
8	9606.ENSP00000339328	0.915	Urokinase plasminogen activator surface receptor
9	9606.ENSP00000265171	0.876	Pro-epidermal growth factor
10	9606.ENSP00000302665	0.861	Insulin-like growth factor I
11	9606.ENSP00000380432	0.833	Insulin
12	9606.ENSP00000422464	0.821	Platelet-derived growth factor C
13	9606.ENSP00000295400	0.813	Protransforming growth factor alpha
14	9606.ENSP00000282397	0.796	Vascular endothelial growth factor receptor 1
15	9606.ENSP00000275493	0.758	Epidermal growth factor receptor
16	9606.ENSP00000263923	0.729	Vascular endothelial growth factor receptor 2
17	9606.ENSP00000261937	0.723	Vascular endothelial growth factor receptor 3
18	9606.ENSP00000393312	0.707	Fibroblast growth factor receptor 1
19	9606.ENSP00000269571	0.702	Receptor tyrosine-protein kinase erbB-2
20	9606.ENSP00000369375	0.690	Angiopoietin-1 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	0.998	growth factor receptor binding
GO:0042802	0.928	identical protein binding
GO:0098772	0.851	molecular function regulator activity
GO:0140677	0.837	molecular function activator activity
GO:0140096	0.497	catalytic activity, acting on a protein
GO:0005161	0.427	platelet-derived growth factor receptor binding
GO:0048018	0.349	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0051716	0.994	cellular response to stimulus
GO:0042221	0.986	response to chemical
GO:0009719	0.984	response to endogenous stimulus
GO:0048522	0.960	positive regulation of cellular process
GO:0071495	0.942	cellular response to endogenous stimulus
GO:0070887	0.938	cellular response to chemical stimulus
GO:0042127	0.928	regulation of cell population proliferation
GO:0030334	0.927	regulation of cell migration
GO:1901701	0.895	cellular response to oxygen-containing compound
GO:0042325	0.893	regulation of phosphorylation
GO:0010033	0.892	response to organic substance
GO:0031399	0.892	regulation of protein modification process
GO:0030335	0.890	positive regulation of cell migration
GO:0048584	0.875	positive regulation of response to stimulus
GO:0070848	0.864	response to growth factor
GO:0007165	0.836	signal transduction
GO:0008284	0.831	positive regulation of cell population proliferation
GO:0006950	0.806	response to stress
GO:0001932	0.783	regulation of protein phosphorylation
GO:0007166	0.777	cell surface receptor signaling pathway
GO:0048660	0.737	regulation of smooth muscle cell proliferation
GO:0071310	0.689	cellular response to organic substance
GO:0032501	0.683	multicellular organismal process
GO:0048519	0.645	negative regulation of biological process
GO:0009966	0.636	regulation of signal transduction
GO:0007167	0.621	enzyme-linked receptor protein signaling pathway
GO:0002685	0.612	regulation of leukocyte migration
GO:0032101	0.611	regulation of response to external stimulus
GO:0007169	0.588	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009893	0.584	positive regulation of metabolic process
GO:0048856	0.573	anatomical structure development
GO:0071363	0.565	cellular response to growth factor stimulus
GO:0048523	0.551	negative regulation of cellular process
GO:0010604	0.547	positive regulation of macromolecule metabolic process
GO:0007275	0.540	multicellular organism development
GO:0051173	0.540	positive regulation of nitrogen compound metabolic process
GO:0071417	0.532	cellular response to organonitrogen compound
GO:0031325	0.526	positive regulation of cellular metabolic process
GO:0065009	0.487	regulation of molecular function
GO:0051247	0.478	positive regulation of protein metabolic process
GO:0051239	0.475	regulation of multicellular organismal process
GO:0008152	0.465	metabolic process
GO:0050790	0.462	regulation of catalytic activity
GO:0048731	0.461	system development
GO:0071704	0.443	organic substance metabolic process
GO:0044093	0.431	positive regulation of molecular function
GO:0042327	0.408	positive regulation of phosphorylation
GO:0044238	0.406	primary metabolic process
GO:0050730	0.402	regulation of peptidyl-tyrosine phosphorylation
GO:0006807	0.397	nitrogen compound metabolic process
GO:0043170	0.389	macromolecule metabolic process
GO:0050920	0.389	regulation of chemotaxis
GO:0001934	0.385	positive regulation of protein phosphorylation
GO:1901564	0.382	organonitrogen compound metabolic process
GO:0043549	0.373	regulation of kinase activity
GO:0051347	0.368	positive regulation of transferase activity
GO:0050921	0.362	positive regulation of chemotaxis
GO:1902531	0.346	regulation of intracellular signal transduction
GO:0009967	0.338	positive regulation of signal transduction
GO:0019538	0.314	protein metabolic process
GO:0033674	0.314	positive regulation of kinase activity
GO:0044237	0.310	cellular metabolic process
GO:0050793	0.306	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0012505	0.983	endomembrane system
GO:0070013	0.977	intracellular organelle lumen
GO:0016020	0.949	membrane
GO:0005615	0.920	extracellular space
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0005737	0.875	cytoplasm
GO:0005886	0.716	plasma membrane
GO:0031090	0.541	organelle membrane
GO:0098588	0.520	bounding membrane of organelle
GO:0031982	0.473	vesicle
GO:0005788	0.468	endoplasmic reticulum lumen
GO:0000139	0.468	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]