StarFunc result for job id Q9GZP9

User Input

>input (239 residues)
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFL
GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH
IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BNI4	0.997	0.997	2.683E-34	239	0.987	0.987	Q8BNI4.pdb.gz	DERL2_MOUSE Derlin-2 OS=Mus musculus OX=10090 GN=Derl2 PE=1 SV=2
2	AFDB:Q96Q80	0.938	0.954	1.620E-28	235	0.741	0.753	Q96Q80.pdb.gz	DERL3_HUMAN Derlin-3 OS=Homo sapiens OX=9606 GN=DERL3 PE=1 SV=2
3	AFDB:Q9VEU2	0.885	0.811	8.547E-25	261	0.628	0.575	Q9VEU2.pdb.gz	Q9VEU2_DROME Derlin OS=Drosophila melanogaster OX=7227 GN=Der-2 PE=1 SV=1
4	AFDB:Q4WDG5	0.816	0.784	3.839E-17	249	0.381	0.365	Q4WDG5.pdb.gz	Q4WDG5_ASPFU Derlin OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G04670 PE=3 SV=1
5	AFDB:Q8VZU9	0.817	0.736	1.049E-16	266	0.368	0.331	Q8VZU9.pdb.gz	DERL1_ARATH Derlin-1 OS=Arabidopsis thaliana OX=3702 GN=DER1 PE=2 SV=1
6	AFDB:A2R4J5	0.812	0.789	1.155E-16	246	0.360	0.350	A2R4J5.pdb.gz	A2R4J5_ASPNC Derlin OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An15g00640 PE=3 SV=1
7	AFDB:A0A024R9G3	0.833	0.795	2.143E-15	251	0.356	0.339	A0A024R9G3.pdb.gz
8	AFDB:Q9VQ57	0.798	0.779	5.052E-14	245	0.276	0.269	Q9VQ57.pdb.gz	DERL1_DROME Derlin-1 OS=Drosophila melanogaster OX=7227 GN=Der-1 PE=2 SV=1
9	AFDB:Q93561	0.822	0.803	9.875E-14	245	0.326	0.318	Q93561.pdb.gz	DERL1_CAEEL Derlin-1 OS=Caenorhabditis elegans OX=6239 GN=cup-2 PE=2 SV=1
10	AFDB:Q382S2	0.773	0.731	2.338E-13	253	0.318	0.300	Q382S2.pdb.gz	Q382S2_TRYB2 Derlin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4430 PE=3 SV=1
11	PDB:7czbA	0.696	0.848	1.546E-7	194	0.310	0.381	7czbA.pdb.gz
12	PDB:6vk0C	0.552	0.703	4.377E-4	180	0.167	0.222	6vk0C.pdb.gz
13	PDB:2nr9A	0.558	0.676	1.588E-2	192	0.151	0.188	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
14	PDB:3odjA	0.440	0.639	1.923E-2	157	0.142	0.217	3odjA.pdb.gz
15	PDB:2w96A	0.225	0.218	2.666	249	0.088	0.084	2w96A.pdb.gz
16	PDB:7pquA	0.136	0.106	2.934	328	0.109	0.079	7pquA.pdb.gz
17	PDB:7xtbR	0.164	0.149	2.934	278	0.126	0.108	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
18	PDB:4bpmA	0.168	0.226	3.387	162	0.105	0.154	4bpmA.pdb.gz	Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
19	PDB:7b93N	0.165	0.126	4.102	345	0.084	0.058	7b93N.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:7qsoN	0.207	0.157	4.736	347	0.105	0.072	7qsoN.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZP9	8.36e-174	479	239	1.000	1.000	DERL2_HUMAN Derlin-2 OS=Homo sapiens OX=9606 GN=DERL2 PE=1 SV=1
2	Q8BNI4	4.39e-172	474	239	0.987	0.987	DERL2_MOUSE Derlin-2 OS=Mus musculus OX=10090 GN=Derl2 PE=1 SV=2
3	Q96Q80	1.31e-118	339	235	0.741	0.753	DERL3_HUMAN Derlin-3 OS=Homo sapiens OX=9606 GN=DERL3 PE=1 SV=2
4	Q9VEU2	4.90e-107	311	261	0.632	0.579	Q9VEU2_DROME Derlin OS=Drosophila melanogaster OX=7227 GN=Der-2 PE=1 SV=1
5	Q4WDG5	1.34e-54	177	249	0.381	0.365	Q4WDG5_ASPFU Derlin OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G04670 PE=3 SV=1
6	A2R4J5	1.74e-51	169	246	0.360	0.350	A2R4J5_ASPNC Derlin OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An15g00640 PE=3 SV=1
7	Q8VZU9	1.22e-46	157	266	0.343	0.308	DERL1_ARATH Derlin-1 OS=Arabidopsis thaliana OX=3702 GN=DER1 PE=2 SV=1
8	Q9BUN8	4.41e-37	132	251	0.360	0.343	DERL1_HUMAN Derlin-1 OS=Homo sapiens OX=9606 GN=DERL1 PE=1 SV=1
9	Q99J56	2.64e-35	127	251	0.347	0.331	DERL1_MOUSE Derlin-1 OS=Mus musculus OX=10090 GN=Derl1 PE=1 SV=1
10	Q93561	7.41e-32	119	245	0.326	0.318	DERL1_CAEEL Derlin-1 OS=Caenorhabditis elegans OX=6239 GN=cup-2 PE=2 SV=1
11	Q9VQ57	1.39e-28	110	245	0.276	0.269	DERL1_DROME Derlin-1 OS=Drosophila melanogaster OX=7227 GN=Der-1 PE=2 SV=1
12	O94458	5.18e-27	104	190	0.238	0.300	YFFH_SCHPO Uncharacterized derlin-like protein C1687.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1687.17c PE=3 SV=2
13	Q382S2	9.09e-26	103	253	0.289	0.273	Q382S2_TRYB2 Derlin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4430 PE=3 SV=1
14	Q386J4	1.25e-21	90.9	205	0.234	0.273	Q386J4_TRYB2 Derlin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0670 PE=3 SV=1
15	Q9Y7Y0	1.39e-18	83.2	224	0.268	0.286	YGR8_SCHPO Uncharacterized derlin-like protein C365.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC365.08c PE=3 SV=1
16	E5RGY0	2.89e-14	70.1	151	0.197	0.311	E5RGY0_HUMAN Derlin OS=Homo sapiens OX=9606 GN=DERL1 PE=1 SV=1
17	Q12743	1.10e-12	68.6	341	0.213	0.150	DFM1_YEAST DER1-like family member protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFM1 PE=1 SV=1
18	B4E1G1	1.53e-10	60.1	151	0.159	0.252	B4E1G1_HUMAN Derlin OS=Homo sapiens OX=9606 GN=DERL1 PE=1 SV=1
19	P38307	3.76e-05	45.4	211	0.172	0.194	DER1_YEAST Degradation in the endoplasmic reticulum protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DER1 PE=1 SV=3
20	Q8IKV3	3.44e-04	43.5	354	0.163	0.110	Q8IKV3_PLAF7 Derlin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1452300 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04511 DER1	1.6e-75	264.8	Der1-like family
2	PF01277 Oleosin	2.2	19.4	Oleosin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006151946.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006149941.1	0.994	E3 ubiquitin-protein ligase synoviolin
2	246437.XP_006143272.1	0.992	Transitional endoplasmic reticulum ATPase
3	246437.XP_006157177.1	0.984	SEL1L ERAD E3 ligase adaptor subunit
4	246437.XP_006143741.1	0.976	SEL1L2 ERAD E3 ligase adaptor subunit
5	246437.XP_006157587.1	0.975	Derlin-1
6	246437.XP_006159085.1	0.960	Endoplasmic reticulum lectin 1
7	246437.XP_006158998.1	0.954	FAS-associated factor 2
8	246437.XP_006160988.1	0.948	Protein OS-9-like
9	246437.XP_006171983.1	0.948	Protein OS-9
10	246437.XP_006150465.1	0.947	Ubiquitin fusion degradation protein 1 homolog
11	246437.XP_006145712.1	0.933	Nuclear protein localization protein 4 like protein
12	246437.XP_006169532.1	0.919	Ubiquitin-conjugating enzyme E2 G2
13	246437.XP_006143390.1	0.918	E3 ubiquitin-protein ligase MARCH6
14	246437.XP_006148534.1	0.916	E3 ubiquitin-protein ligase AMFR
15	246437.XP_006167740.1	0.866	ATPase family AAA domain-containing protein 2B
16	246437.XP_006167245.1	0.858	UBX domain-containing protein 8 isoform X1
17	246437.XP_006162803.1	0.850	Selenoprotein S
18	246437.XP_006165442.1	0.833	Alpha-1-antitrypsin
19	246437.XP_006140311.1	0.810	ERGIC and golgi 2
20	246437.XP_006157606.1	0.804	E3 ubiquitin-protein ligase RNF139

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0043021	0.990	ribonucleoprotein complex binding
GO:0005047	0.603	signal recognition particle binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0015031	0.995	protein transport
GO:0051716	0.993	cellular response to stimulus
GO:0006950	0.990	response to stress
GO:0019538	0.990	protein metabolic process
GO:0034976	0.980	response to endoplasmic reticulum stress
GO:0032527	0.977	protein exit from endoplasmic reticulum
GO:0010243	0.975	response to organonitrogen compound
GO:0036503	0.972	ERAD pathway
GO:0044237	0.924	cellular metabolic process
GO:0065007	0.900	biological regulation
GO:0044260	0.875	cellular macromolecule metabolic process
GO:0044265	0.840	cellular macromolecule catabolic process
GO:0050789	0.771	regulation of biological process
GO:0043161	0.737	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0050794	0.721	regulation of cellular process
GO:0030433	0.693	ubiquitin-dependent ERAD pathway
GO:0035966	0.449	response to topologically incorrect protein
GO:0035967	0.422	cellular response to topologically incorrect protein
GO:0048523	0.375	negative regulation of cellular process
GO:0006986	0.359	response to unfolded protein
GO:0034620	0.326	cellular response to unfolded protein
GO:0030970	0.316	retrograde protein transport, ER to cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.996	membrane
GO:0031090	0.969	organelle membrane
GO:0031984	0.929	organelle subcompartment
GO:0005789	0.921	endoplasmic reticulum membrane
GO:0031982	0.765	vesicle
GO:0005768	0.323	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]