StarFunc result for job id Q9GZR1

User Input

>input (1112 residues)
MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDE
DSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNMLSNNKKLSEN
TQNTSLCSGTVVHGRRFHHAHAQIPVVKTAAQSSLDRKERKEYPPHVQKVEINPVRLSRL
QGVERIMKKTEESESQVEPEIKRKVQQKRHCSTYQPTPPLSPASKKCLTHLEDLQRNCRQ
AITLNESTGPLLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPIDIIVNCDDSKHTYLQ
TNGKVILPGAKIPKITNLKERKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQPADSAC
SSPAPSTGKVEAALNENTCRAERELRSIPEDSELNTVTLPRKARMKDQFGNSIINTPLKR
RKVFSQEPPDALALSCQSSFDSVILNCRSIRVGTLFRLLIEPVIFCLDFIKIQLDEPDHD
PVEIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSIQLQMNKEDKVWNDCKGVNKLT
NLEEQYIILIFQNGLDPPANMVFESIINEIGIKNNISNFFAKIPFEEANGRLVACTRTYE
ESIKGSCGQKENKIKTVSFESKIQLRSKQEFQFFDEEEETGENHTIFIGPVEKLIVYPPP
PAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQ
RERRNHETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGLEKPK
YEPNPHYHENAVIQKCSTVEDSCISSSASEMESCSQNSSAKPVIKKMLNKKHCIAVIDSN
PGQEESDPRYKRNICSVKYSVKKINHTASENEEFNKGESTSQKVADRTKSENGLQNESLS
STHHTDGLSKIRLNYSDESPEAGKMLEDELVDFSEDQDNQDDSSDDGFLADDNCSSEIGQ
WHLKPTICKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGSKRSFSKDVMKGSNPK
VPQQNNFSDCGVYVLQYVESFFENPILSFELPMNLANWFPPPRMRTKREEIRNIILKLQE
DQSKEKRKHKDTYSTEAPLGEGTEQYVNSISD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZR1	1.000	1.000	0.000	1112	1.000	1.000	Q9GZR1.pdb.gz	SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2
2	AFDB:Q8BUH8	0.232	0.249	3.029E-47	1037	0.235	0.252	Q8BUH8.pdb.gz	SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus OX=10090 GN=Senp7 PE=1 SV=1
3	AFDB:D3Z8E6	0.042	0.034	9.360E-4	1604	0.125	0.087	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
4	AFDB:Q86A78	0.055	0.050	1.100E-3	1282	0.127	0.110	Q86A78.pdb.gz	Q86A78_DICDI Calcium-binding EF-hand domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1124 PE=4 SV=1
5	PDB:2bkrA	0.077	0.372	2.170E-3	211	0.019	0.100	2bkrA.pdb.gz
6	AFDB:P34288	0.061	0.045	6.180E-3	1605	0.088	0.061	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
7	AFDB:P38800	0.072	0.061	7.265E-3	1345	0.085	0.070	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
8	AFDB:Q8INM3	0.046	0.037	2.379E-2	1420	0.123	0.096	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
9	AFDB:P32634	0.055	0.042	2.952E-2	1753	0.132	0.084	P32634.pdb.gz	PMD1_YEAST Negative regulator of sporulation PMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMD1 PE=1 SV=1
10	AFDB:Q54F55	0.046	0.033	3.866E-2	1820	0.102	0.062	Q54F55.pdb.gz	Q54F55_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=pikH PE=3 SV=1
11	AFDB:Q6ZPF3	0.087	0.068	3.866E-2	1715	0.116	0.075	Q6ZPF3.pdb.gz	TIAM2_MOUSE Rho guanine nucleotide exchange factor TIAM2 OS=Mus musculus OX=10090 GN=Tiam2 PE=1 SV=2
12	PDB:7nkyQ	0.081	0.198	4.446E-2	404	0.016	0.045	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
13	PDB:4mk0A	0.072	0.119	7.224E-2	631	0.008	0.014	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:3pvuA	0.071	0.121	8.492E-2	609	0.007	0.013	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
15	PDB:2kr0A	0.073	0.163	9.459E-2	407	0.027	0.074	2kr0A.pdb.gz
16	PDB:7nkyO	0.060	0.137	1.174E-1	427	0.013	0.033	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
17	PDB:5oa30	0.031	0.055	1.622E-1	479	0.010	0.023	5oa30.pdb.gz	Structural and Functional Insights into Human Re-initiation Complexes.
18	PDB:6wxuB	0.046	0.129	2.497E-1	273	0.014	0.059	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
19	PDB:3cm1A	0.059	0.282	3.270E-1	137	0.013	0.102	3cm1A.pdb.gz
20	PDB:6xtbE	0.072	0.283	4.057E-1	235	0.014	0.068	6xtbE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W6D9	0.0	1404	685	0.616	1.000	F8W6D9_HUMAN SUMO specific peptidase 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=1
2	H0Y4F4	0.0	1200	582	0.523	1.000	H0Y4F4_HUMAN SUMO specific peptidase 6 (Fragment) OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=1
3	Q9GZR1	0.0	2301	1112	1.000	1.000	SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2
4	Q8BUH8	2.05e-55	212	1037	0.103	0.111	SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus OX=10090 GN=Senp7 PE=1 SV=1
5	Q9BQF6	7.52e-55	210	1050	0.098	0.104	SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7 PE=1 SV=4
6	Q9VYJ5	9.26e-36	147	681	0.058	0.094	Q9VYJ5_DROME FI06413p OS=Drosophila melanogaster OX=7227 GN=pira PE=2 SV=3
7	Q9VRY4	7.57e-32	137	1833	0.055	0.033	Q9VRY4_DROME LD13895p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=3
8	Q8MR14	8.64e-32	135	711	0.055	0.086	Q8MR14_DROME LD44235p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=1
9	O13769	8.46e-24	110	638	0.048	0.083	ULP2_SCHPO Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ulp2 PE=1 SV=2
10	F4I133	6.14e-13	75.9	963	0.046	0.053	F4I133_ARATH Cysteine proteinases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ASP1 PE=1 SV=1
11	Q8RWN0	6.23e-13	75.1	571	0.035	0.068	ULP1C_ARATH Ubiquitin-like-specific protease 1C OS=Arabidopsis thaliana OX=3702 GN=ULP1C PE=1 SV=1
12	Q6IE23	6.95e-13	74.7	475	0.032	0.076	Q6IE23_RAT Sentrin/SUMO-specific protease 17 OS=Rattus norvegicus OX=10116 GN=Senp17 PE=2 SV=1
13	P40537	1.83e-12	74.3	1034	0.029	0.031	ULP2_YEAST Ubiquitin-like-specific protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULP2 PE=1 SV=1
14	P59110	2.67e-12	73.6	640	0.031	0.055	SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1
15	Q9P0U3	2.80e-12	73.2	644	0.031	0.054	SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 PE=1 SV=2
16	Q91ZX6	2.82e-12	73.2	588	0.040	0.077	SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus OX=10090 GN=Senp2 PE=1 SV=2
17	Q2PS26	5.77e-12	72.0	584	0.033	0.063	ULP1D_ARATH Ubiquitin-like-specific protease 1D OS=Arabidopsis thaliana OX=3702 GN=ULP1D PE=1 SV=1
18	Q9HC62	7.04e-12	72.0	589	0.031	0.059	SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens OX=9606 GN=SENP2 PE=1 SV=3
19	Q09275	2.01e-11	69.7	382	0.037	0.107	ULP4_CAEEL Ubiquitin-like protease 4 OS=Caenorhabditis elegans OX=6239 GN=ulp-4 PE=1 SV=2
20	Q23238	1.06e-10	68.6	893	0.036	0.045	ULP2_CAEEL Ubiquitin-like protease 2 OS=Caenorhabditis elegans OX=6239 GN=ulp-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02902 Peptidase_C48	3.7e-31	120.2	Ulp1 protease family, C-terminal catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405965	0.990	Small ubiquitin-related modifier 2
2	9606.ENSP00000376077	0.949	Small ubiquitin-related modifier 1
3	9606.ENSP00000254719	0.932	Replication protein A 70 kDa DNA-binding subunit
4	9606.ENSP00000318635	0.916	Small ubiquitin-related modifier 4
5	9606.ENSP00000348056	0.907	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000357402	0.907	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
7	9606.ENSP00000409666	0.898	Small ubiquitin-like modifier 3
8	9606.ENSP00000394791	0.865	Sentrin-specific protease 1
9	9606.ENSP00000270225	0.849	SUMO-activating enzyme subunit 1
10	9606.ENSP00000386433	0.835	Zinc finger protein 638
11	9606.ENSP00000246548	0.832	SUMO-activating enzyme subunit 2
12	9606.ENSP00000340505	0.811	Sentrin-specific protease 8
13	9606.ENSP00000227524	0.804	Pre-mRNA-processing factor 19
14	9606.ENSP00000282516	0.788	Nipped-B-like protein
15	9606.ENSP00000401470	0.773	Ran GTPase-activating protein 1
16	9606.ENSP00000287437	0.759	E3 SUMO-protein ligase NSE2
17	9606.ENSP00000262971	0.755	E3 SUMO-protein ligase PIAS4
18	9606.ENSP00000465676	0.754	E3 SUMO-protein ligase PIAS2
19	9606.ENSP00000249636	0.750	E3 SUMO-protein ligase PIAS1
20	9606.ENSP00000358723	0.745	Ras-related protein Rap-1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070139	1.000	SUMO-specific endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0018205	0.993	peptidyl-lysine modification
GO:0050794	0.992	regulation of cellular process
GO:0010564	0.973	regulation of cell cycle process
GO:0070646	0.966	protein modification by small protein removal
GO:0033043	0.961	regulation of organelle organization
GO:0032886	0.925	regulation of microtubule-based process
GO:0033044	0.916	regulation of chromosome organization
GO:0044087	0.898	regulation of cellular component biogenesis
GO:0051493	0.898	regulation of cytoskeleton organization
GO:0070507	0.833	regulation of microtubule cytoskeleton organization
GO:0043254	0.812	regulation of protein-containing complex assembly
GO:0090224	0.791	regulation of spindle organization
GO:1902115	0.738	regulation of organelle assembly
GO:0009987	0.637	cellular process
GO:0019222	0.604	regulation of metabolic process
GO:0051171	0.406	regulation of nitrogen compound metabolic process
GO:0060255	0.395	regulation of macromolecule metabolic process
GO:0080090	0.390	regulation of primary metabolic process
GO:0031323	0.361	regulation of cellular metabolic process
GO:0048518	0.310	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.459	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]