StarFunc result for job id Q9GZS3

User Input

>input (305 residues)
MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSL
EGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQY
LATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATG
KLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAF
CPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHI
YDCPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ERF3	0.994	0.994	3.303E-57	305	0.974	0.974	Q9ERF3.pdb.gz	SKI8_MOUSE Superkiller complex protein 8 OS=Mus musculus OX=10090 GN=Skic8 PE=1 SV=1
2	PDB:7qdrC	0.975	0.975	4.529E-49	305	1.000	1.000	7qdrC.pdb.gz
3	AFDB:Q9SZQ5	0.931	0.887	2.075E-33	321	0.390	0.371	Q9SZQ5.pdb.gz	VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana OX=3702 GN=VIP3 PE=1 SV=1
4	AFDB:Q09150	0.897	0.905	8.932E-28	302	0.298	0.301	Q09150.pdb.gz	REC14_SCHPO Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rec14 PE=1 SV=1
5	AFDB:Q57W14	0.791	0.594	5.214E-27	419	0.272	0.198	Q57W14.pdb.gz	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
6	AFDB:Q1LV15	0.794	0.602	8.761E-27	415	0.239	0.176	Q1LV15.pdb.gz	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
7	AFDB:Q8N136	0.797	0.605	5.673E-26	415	0.233	0.171	Q8N136.pdb.gz	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
8	PDB:5mzhB	0.777	0.590	2.701E-25	415	0.252	0.186	5mzhB.pdb.gz
9	AFDB:A2CEH0	0.915	0.576	3.488E-25	490	0.230	0.143	A2CEH0.pdb.gz	POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio OX=7955 GN=poc1b PE=2 SV=1
10	AFDB:D3Z7A5	0.797	0.604	3.870E-25	415	0.233	0.171	D3Z7A5.pdb.gz	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
11	AFDB:Q3Y8L7	0.785	0.558	5.283E-25	446	0.246	0.168	Q3Y8L7.pdb.gz	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
12	AFDB:D6QUQ2	0.913	0.608	7.597E-25	463	0.226	0.149	D6QUQ2.pdb.gz	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
13	PDB:5yzgs	0.895	0.736	1.715E-23	374	0.226	0.184	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:5nnzA	0.778	0.716	1.597E-22	335	0.233	0.212	5nnzA.pdb.gz
15	PDB:5jcsq	0.739	0.484	1.966E-22	488	0.259	0.162	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
16	PDB:7mqaLQ	0.854	0.324	4.749E-22	830	0.210	0.077	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7bt6x	0.740	0.486	1.089E-21	488	0.239	0.150	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
18	PDB:7apkC	0.877	0.880	1.209E-21	304	0.193	0.194	7apkC.pdb.gz
19	PDB:7jvrB	0.869	0.780	4.906E-21	342	0.174	0.155	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:2h9lA	0.885	0.843	6.038E-21	321	0.252	0.240	2h9lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YN81	0.0	597	294	0.964	1.000	H0YN81_HUMAN SKI8 subunit of superkiller complex (Fragment) OS=Homo sapiens OX=9606 GN=SKIC8 PE=1 SV=1
2	Q9ERF3	0.0	611	305	0.974	0.974	SKI8_MOUSE Superkiller complex protein 8 OS=Mus musculus OX=10090 GN=Skic8 PE=1 SV=1
3	Q9GZS3	0.0	622	305	1.000	1.000	SKI8_HUMAN Superkiller complex protein 8 OS=Homo sapiens OX=9606 GN=SKIC8 PE=1 SV=1
4	Q9SZQ5	2.17e-70	223	321	0.384	0.364	VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana OX=3702 GN=VIP3 PE=1 SV=1
5	Q09150	1.04e-42	150	302	0.318	0.321	REC14_SCHPO Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rec14 PE=1 SV=1
6	Q57W14	8.88e-38	140	419	0.279	0.203	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
7	Q3Y8L7	3.34e-33	128	446	0.266	0.182	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
8	Q9D4T2	1.06e-32	124	304	0.226	0.227	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
9	Q54KL5	2.17e-32	124	335	0.220	0.200	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
10	Q9D994	7.46e-32	122	303	0.289	0.290	WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus OX=10090 GN=Wdr38 PE=2 SV=1
11	D3Z7A5	1.14e-31	124	415	0.226	0.166	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
12	Q8N136	1.64e-31	123	415	0.226	0.166	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
13	P61964	1.46e-29	116	334	0.210	0.192	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
14	P61965	1.46e-29	116	334	0.210	0.192	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
15	Q498M4	1.46e-29	116	334	0.210	0.192	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
16	Q1LV15	1.65e-29	118	415	0.230	0.169	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
17	Q7ZTX2	3.19e-29	115	334	0.210	0.192	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
18	Q9V3J8	3.68e-28	113	361	0.230	0.194	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
19	D6QUQ2	8.24e-28	114	463	0.207	0.136	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
20	Q4V8C4	2.43e-27	110	328	0.203	0.189	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.4e-19	81.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02239 Cytochrom_D1	0.036	24.2	Cytochrome D1 heme domain
3	PF10313 DUF2415	1.2e+02	14.0	Uncharacterised protein domain (DUF2415)
4	PF08662 eIF2A	1.6e-08	46.2	Eukaryotic translation initiation factor eIF2A
5	PF16529 Ge1_WD40	0.00014	32.6	WD40 region of Ge1, enhancer of mRNA-decapping protein
6	PF07995 GSDH	4	18.3	Glucose / Sorbosone dehydrogenase
7	PF20426 NBCH_WD40	7.6e-05	33.3	Neurobeachin beta propeller domain
8	PF08801 Nucleoporin_N	91	13.2	Nup133 N terminal like
9	PF11715 Nup160	1.3	19.4	Nucleoporin Nup120/160
10	PF07676 PD40	0.67	21.2	WD40-like Beta Propeller Repeat
11	PF00400 WD40	2.9e-38	140.4	WD domain, G-beta repeat
12	PF17005 WD40_like	49	14.7	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000010406

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017133	0.997	Tetratricopeptide repeat domain 37
2	61853.ENSNLEP00000021930	0.997	Cell division cycle 73
3	61853.ENSNLEP00000017576	0.996	PAF1 homolog, Paf1/RNA polymerase II complex component
4	61853.ENSNLEP00000007867	0.994	Ski2 like RNA helicase
5	61853.ENSNLEP00000007876	0.994	Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
6	61853.ENSNLEP00000021390	0.994	CTR9, Paf1/RNA polymerase II complex component
7	61853.ENSNLEP00000004375	0.972	Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
8	61853.ENSNLEP00000002410	0.904	Peroxisomal biogenesis factor 2
9	61853.ENSNLEP00000008596	0.902	SPO11, initiator of meiotic double stranded breaks
10	61853.ENSNLEP00000017931	0.889	HBS1-like translational GTPase
11	61853.ENSNLEP00000017482	0.864	Transcription elongation factor SPT5
12	61853.ENSNLEP00000016861	0.857	Exosome component 1
13	61853.ENSNLEP00000023474	0.835	Exosome component 4
14	61853.ENSNLEP00000011566	0.831	WD and tetratricopeptide repeats 1
15	61853.ENSNLEP00000018049	0.831	DDB1 and CUL4 associated factor 6
16	61853.ENSNLEP00000004270	0.815	Exosome component 3
17	61853.ENSNLEP00000016616	0.804	Exosome component 5
18	61853.ENSNLEP00000011357	0.784	Exosome component 9
19	61853.ENSNLEP00000019502	0.771	DIS3 exosome endoribonuclease and 3'-5' exoribonuclease
20	61853.ENSNLEP00000017557	0.760	SPT16 homolog, facilitates chromatin remodeling subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0065007	0.985	biological regulation
GO:0044237	0.985	cellular metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0050789	0.977	regulation of biological process
GO:0043170	0.966	macromolecule metabolic process
GO:0044260	0.921	cellular macromolecule metabolic process
GO:0019222	0.917	regulation of metabolic process
GO:0050794	0.912	regulation of cellular process
GO:0034641	0.881	cellular nitrogen compound metabolic process
GO:0060255	0.879	regulation of macromolecule metabolic process
GO:0010467	0.876	gene expression
GO:0008213	0.865	protein alkylation
GO:0016570	0.840	histone modification
GO:0018022	0.789	peptidyl-lysine methylation
GO:1901576	0.776	organic substance biosynthetic process
GO:0044249	0.774	cellular biosynthetic process
GO:0051568	0.770	histone H3-K4 methylation
GO:0051171	0.765	regulation of nitrogen compound metabolic process
GO:0009059	0.759	macromolecule biosynthetic process
GO:0044271	0.757	cellular nitrogen compound biosynthetic process
GO:0080090	0.755	regulation of primary metabolic process
GO:1901360	0.685	organic cyclic compound metabolic process
GO:0006139	0.678	nucleobase-containing compound metabolic process
GO:0090304	0.670	nucleic acid metabolic process
GO:0016070	0.655	RNA metabolic process
GO:0031323	0.530	regulation of cellular metabolic process
GO:0051246	0.492	regulation of protein metabolic process
GO:0048518	0.486	positive regulation of biological process
GO:0031399	0.450	regulation of protein modification process
GO:0048522	0.447	positive regulation of cellular process
GO:0048519	0.409	negative regulation of biological process
GO:0010468	0.376	regulation of gene expression
GO:0006354	0.364	DNA-templated transcription elongation
GO:0009893	0.319	positive regulation of metabolic process
GO:0048523	0.318	negative regulation of cellular process
GO:0010604	0.313	positive regulation of macromolecule metabolic process
GO:0051173	0.312	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005829	0.990	cytosol
GO:0140513	0.985	nuclear protein-containing complex
GO:1990234	0.979	transferase complex
GO:0140535	0.968	intracellular protein-containing complex
GO:0043232	0.947	intracellular non-membrane-bounded organelle
GO:0061695	0.871	transferase complex, transferring phosphorus-containing groups
GO:0016591	0.862	RNA polymerase II, holoenzyme
GO:0008023	0.845	transcription elongation factor complex
GO:0016593	0.753	Cdc73/Paf1 complex
GO:0005694	0.446	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]