StarFunc result for job id Q9GZT4

User Input

>input (340 residues)
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGA
LNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQA
YGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDAL
VVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGV
KSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT
VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZT4	1.000	1.000	8.757E-72	340	1.000	1.000	Q9GZT4.pdb.gz	SRR_HUMAN Serine racemase OS=Homo sapiens OX=9606 GN=SRR PE=1 SV=1
2	AFDB:Q9QZX7	0.958	0.960	1.006E-65	339	0.897	0.900	Q9QZX7.pdb.gz	SRR_MOUSE Serine racemase OS=Mus musculus OX=10090 GN=Srr PE=1 SV=1
3	PDB:7nbcAAA	0.893	0.938	8.664E-61	323	0.947	0.997	7nbcAAA.pdb.gz	Tyrosine 121 moves revealing a ligandable pocket that couples catalysis to ATP-binding in serine racemase.
4	AFDB:Q54HH2	0.913	0.957	1.227E-43	324	0.462	0.485	Q54HH2.pdb.gz	SRR_DICDI Probable serine racemase OS=Dictyostelium discoideum OX=44689 GN=srr PE=1 SV=1
5	AFDB:Q7XSN8	0.909	0.911	3.123E-43	339	0.441	0.442	Q7XSN8.pdb.gz	SRR_ORYSJ Serine racemase OS=Oryza sativa subsp. japonica OX=39947 GN=SERR PE=1 SV=2
6	AFDB:Q2PGG3	0.898	0.922	9.470E-43	331	0.468	0.480	Q2PGG3.pdb.gz	SRR_ARATH Serine racemase OS=Arabidopsis thaliana OX=3702 GN=SR PE=1 SV=1
7	PDB:6lutA	0.849	0.936	1.673E-40	307	0.453	0.502	6lutA.pdb.gz
8	AFDB:A1B8Z2	0.876	0.944	3.447E-40	315	0.403	0.435	A1B8Z2.pdb.gz	BHCB_PARDP beta-hydroxyaspartate dehydratase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=bhcB PE=1 SV=1
9	PDB:2zpuA	0.884	0.940	6.721E-35	319	0.371	0.395	2zpuA.pdb.gz	Serine racemase with catalytically active lysinoalanyl residue.
10	AFDB:P36007	0.880	0.916	7.724E-35	326	0.388	0.405	P36007.pdb.gz	LTHAD_YEAST L-threo-3-hydroxyaspartate ammonia-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRY1 PE=1 SV=1
11	AFDB:A4F2N8	0.876	0.931	1.096E-34	319	0.371	0.395	A4F2N8.pdb.gz	LTHAD_PSESP L-threo-3-hydroxyaspartate ammonia-lyase OS=Pseudomonas sp. OX=306 GN=thadh PE=1 SV=1
12	AFDB:O59791	0.883	0.927	9.510E-34	323	0.371	0.390	O59791.pdb.gz	SRR_SCHPO Serine racemase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SRR PE=1 SV=1
13	AFDB:P0AGF6	0.890	0.918	1.105E-32	329	0.318	0.328	P0AGF6.pdb.gz	TDCB_ECOLI L-threonine dehydratase catabolic TdcB OS=Escherichia coli (strain K12) OX=83333 GN=tdcB PE=1 SV=1
14	PDB:1tdjA	0.845	0.593	1.980E-26	494	0.268	0.184	1tdjA.pdb.gz	Structure and control of pyridoxal phosphate dependent allosteric threonine deaminase.
15	PDB:1pwhA	0.808	0.838	3.314E-21	327	0.241	0.251	1pwhA.pdb.gz	Crystal structure of serine dehydratase from rat liver.
16	PDB:2rkbA	0.792	0.843	3.724E-21	318	0.241	0.258	2rkbA.pdb.gz	A catalytic mechanism that explains a low catalytic activity of serine dehydratase like-1 from human cancer cells: Crystal structure and site-directed mutagenesis studies.
17	PDB:1p5jA	0.792	0.842	5.942E-21	319	0.232	0.248	1p5jA.pdb.gz	Crystallization and preliminary crystallographic analysis of human serine dehydratase.
18	PDB:2q3dA	0.731	0.806	2.218E-19	306	0.226	0.252	2q3dA.pdb.gz	Structural Insights into Catalysis and Inhibition of O-Acetylserine Sulfhydrylase from Mycobacterium tuberculosis: CRYSTAL STRUCTURES OF THE ENZYME {alpha}-AMINOACRYLATE INTERMEDIATE AND AN ENZYME-INHIBITOR COMPLEX.
19	PDB:4d9gB	0.812	0.711	7.561E-19	392	0.174	0.151	4d9gB.pdb.gz
20	PDB:2isqA	0.745	0.788	9.550E-19	320	0.182	0.194	2isqA.pdb.gz	Structural basis for interaction of o-acetylserine sulfhydrylase and serine acetyltransferase in the Arabidopsis cysteine synthase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76EQ0	0.0	606	333	0.894	0.913	SRR_RAT Serine racemase OS=Rattus norvegicus OX=10116 GN=Srr PE=1 SV=1
2	Q9GZT4	0.0	698	340	1.000	1.000	SRR_HUMAN Serine racemase OS=Homo sapiens OX=9606 GN=SRR PE=1 SV=1
3	Q9QZX7	0.0	606	339	0.897	0.900	SRR_MOUSE Serine racemase OS=Mus musculus OX=10090 GN=Srr PE=1 SV=1
4	Q54HH2	2.70e-106	315	324	0.459	0.481	SRR_DICDI Probable serine racemase OS=Dictyostelium discoideum OX=44689 GN=srr PE=1 SV=1
5	Q2PGG3	1.39e-100	301	331	0.476	0.489	SRR_ARATH Serine racemase OS=Arabidopsis thaliana OX=3702 GN=SR PE=1 SV=1
6	Q7XSN8	1.44e-99	299	339	0.444	0.445	SRR_ORYSJ Serine racemase OS=Oryza sativa subsp. japonica OX=39947 GN=SERR PE=1 SV=2
7	A1B8Z2	1.63e-87	267	315	0.418	0.451	BHCB_PARDP beta-hydroxyaspartate dehydratase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=bhcB PE=1 SV=1
8	P36007	1.63e-69	222	326	0.391	0.408	LTHAD_YEAST L-threo-3-hydroxyaspartate ammonia-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRY1 PE=1 SV=1
9	O59791	2.39e-62	203	323	0.376	0.396	SRR_SCHPO Serine racemase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SRR PE=1 SV=1
10	A4F2N8	8.73e-62	201	319	0.374	0.398	LTHAD_PSESP L-threo-3-hydroxyaspartate ammonia-lyase OS=Pseudomonas sp. OX=306 GN=thadh PE=1 SV=1
11	Q59P56	6.84e-40	149	569	0.291	0.174	Q59P56_CANAL Threonine dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ILV1 PE=3 SV=1
12	P0AGF6	5.73e-39	142	329	0.341	0.353	TDCB_ECOLI L-threonine dehydratase catabolic TdcB OS=Escherichia coli (strain K12) OX=83333 GN=tdcB PE=1 SV=1
13	Q10725	5.88e-39	142	326	0.268	0.279	FSDH_RALPI Phenylserine dehydratase OS=Ralstonia pickettii OX=329 GN=psdht PE=1 SV=3
14	Q9AXU4	1.52e-37	143	601	0.276	0.156	TD_NICAT Threonine dehydratase OS=Nicotiana attenuata OX=49451 GN=TD PE=1 SV=1
15	O94634	1.50e-35	138	600	0.312	0.177	THDH_SCHPO Threonine dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1677.03c PE=3 SV=1
16	P25306	4.33e-34	134	595	0.279	0.160	TD2_SOLLC Threonine dehydratase 2 biosynthetic, chloroplastic OS=Solanum lycopersicum OX=4081 GN=TD2 PE=1 SV=1
17	Q9VHF0	1.09e-31	125	469	0.344	0.249	Q9VHF0_DROME LP08712p OS=Drosophila melanogaster OX=7227 GN=Srr PE=1 SV=1
18	P00927	1.51e-31	126	576	0.309	0.182	THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ILV1 PE=1 SV=2
19	P04968	1.30e-27	115	514	0.268	0.177	ILVA_ECOLI L-threonine dehydratase biosynthetic IlvA OS=Escherichia coli (strain K12) OX=83333 GN=ilvA PE=1 SV=1
20	Q9ZSS6	2.86e-27	114	592	0.276	0.159	THD1_ARATH Threonine dehydratase biosynthetic, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OMR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13548 DUF4126	3.4e+02	12.3	Domain of unknown function (DUF4126)
2	PF00291 PALP	1.9e-71	252.5	Pyridoxal-phosphate dependent enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339435

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355593	0.941	Disrupted in schizophrenia 1 protein
2	9606.ENSP00000378854	0.934	Phosphoserine phosphatase
3	9606.ENSP00000318868	0.932	Serine hydroxymethyltransferase, cytosolic
4	9606.ENSP00000257549	0.929	L-serine dehydratase/L-threonine deaminase
5	9606.ENSP00000302620	0.923	Alanine-glyoxylate aminotransferase
6	9606.ENSP00000333667	0.920	Serine hydroxymethyltransferase, mitochondrial
7	9606.ENSP00000385790	0.919	Serine dehydratase-like
8	9606.ENSP00000381231	0.916	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
9	9606.ENSP00000228476	0.900	D-amino-acid oxidase
10	9606.ENSP00000385205	0.816	PRKCA-binding protein
11	9606.ENSP00000216484	0.815	Serine palmitoyltransferase 2
12	9606.ENSP00000381968	0.815	Serine palmitoyltransferase 3
13	9606.ENSP00000262554	0.813	Serine palmitoyltransferase 1
14	9606.ENSP00000482954	0.720	Prolactin receptor
15	9606.ENSP00000357920	0.697	D-aspartate oxidase
16	9606.ENSP00000360608	0.675	Glutamate receptor ionotropic, NMDA 1
17	9606.ENSP00000315370	0.646	Uncharacterized protein C5orf46
18	9606.ENSP00000237014	0.631	Transthyretin
19	9606.ENSP00000299709	0.631	Putative sodium-coupled neutral amino acid transporter 8
20	9606.ENSP00000269576	0.628	Keratin, type I cytoskeletal 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0047661	1.000	amino-acid racemase activity
GO:0030170	1.000	pyridoxal phosphate binding
GO:0005524	0.999	ATP binding
GO:0046872	0.998	metal ion binding
GO:0016841	0.998	ammonia-lyase activity
GO:0000287	0.992	magnesium ion binding
GO:0030378	0.645	serine racemase activity
GO:0016740	0.447	transferase activity
GO:0003941	0.428	L-serine ammonia-lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006563	0.991	L-serine metabolic process
GO:0044249	0.851	cellular biosynthetic process
GO:1901576	0.839	organic substance biosynthetic process
GO:0044283	0.749	small molecule biosynthetic process
GO:0046394	0.636	carboxylic acid biosynthetic process
GO:1901566	0.576	organonitrogen compound biosynthetic process
GO:0050896	0.488	response to stimulus
GO:1901607	0.324	alpha-amino acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.990	membrane
GO:0005886	0.980	plasma membrane
GO:0005829	0.976	cytosol
GO:0044297	0.712	cell body
GO:0036477	0.692	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18317	1.000	an L-alpha-amino acid = a D-alpha-amino acid
EC:5.1.1.10	1.000	amino-acid racemase.
EC:4.3.1.-	0.998	Ammonia-lyases.
RHEA:10980	0.645	L-serine = D-serine
EC:5.1.1.18	0.645	serine racemase.
EC:2.-.-.-	0.447	Transferases.
RHEA:19169	0.428	L-serine = NH4(+) + pyruvate
EC:4.3.1.17	0.428	L-serine ammonia-lyase.

[back to server]