StarFunc result for job id Q9GZT5

User Input

>input (417 residues)
MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70701	0.872	0.872	1.639E-66	417	0.952	0.952	P70701.pdb.gz	WN10A_MOUSE Protein Wnt-10a OS=Mus musculus OX=10090 GN=Wnt10a PE=2 SV=1
2	AFDB:P43446	0.854	0.806	2.569E-55	442	0.686	0.647	P43446.pdb.gz	WN10A_DANRE Protein Wnt-10a OS=Danio rerio OX=7955 GN=wnt10a PE=1 SV=1
3	AFDB:Q801F7	0.776	0.758	3.797E-48	427	0.590	0.576	Q801F7.pdb.gz	WN10B_DANRE Protein Wnt-10b OS=Danio rerio OX=7955 GN=wnt10b PE=2 SV=1
4	AFDB:O00744	0.763	0.817	8.292E-48	389	0.576	0.617	O00744.pdb.gz	WN10B_HUMAN Protein Wnt-10b OS=Homo sapiens OX=9606 GN=WNT10B PE=1 SV=2
5	AFDB:Q93097	0.704	0.750	5.757E-34	391	0.379	0.404	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
6	AFDB:Q3L254	0.666	0.789	1.395E-33	349	0.355	0.424	Q3L254.pdb.gz	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
7	AFDB:Q3C2H6	0.689	0.808	2.607E-33	353	0.341	0.402	Q3C2H6.pdb.gz	Q3C2H6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt6 PE=2 SV=1
8	AFDB:B0S7E3	0.684	0.718	2.893E-33	396	0.355	0.374	B0S7E3.pdb.gz
9	AFDB:M0R9D3	0.683	0.808	2.893E-33	349	0.350	0.418	M0R9D3.pdb.gz	M0R9D3_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7a PE=3 SV=1
10	AFDB:Q98SN7	0.686	0.739	3.954E-33	385	0.379	0.410	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
11	PDB:6ahyB	0.640	0.840	1.815E-28	313	0.321	0.428	6ahyB.pdb.gz
12	PDB:4f0aB	0.597	0.829	3.904E-22	294	0.259	0.367	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7sptA	0.067	0.061	2.751	470	0.036	0.032	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
14	PDB:8a1dA	0.043	0.035	3.216	533	0.026	0.021	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
15	PDB:6sb3A	0.070	0.050	3.760	604	0.014	0.010	6sb3A.pdb.gz
16	PDB:7s7gA	0.106	0.086	4.173	571	0.086	0.063	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
17	PDB:6bzoF	0.079	0.096	5.703	326	0.053	0.067	6bzoF.pdb.gz	Fidaxomicin jamsMycobacterium tuberculosisRNA polymerase motions needed for initiation via RbpA contacts.
18	PDB:7c7sA	0.128	0.091	5.703	685	0.050	0.031	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
19	PDB:4v8mA2	0.072	0.123	6.329	187	0.029	0.064	4v8mA2.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:3b07B	0.072	0.104	6.667	270	0.002	0.004	3b07B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43446	0.0	578	442	0.686	0.647	WN10A_DANRE Protein Wnt-10a OS=Danio rerio OX=7955 GN=wnt10a PE=1 SV=1
2	P70701	0.0	767	417	0.952	0.952	WN10A_MOUSE Protein Wnt-10a OS=Mus musculus OX=10090 GN=Wnt10a PE=2 SV=1
3	Q9GZT5	0.0	853	417	1.000	1.000	WN10A_HUMAN Protein Wnt-10a OS=Homo sapiens OX=9606 GN=WNT10A PE=1 SV=1
4	Q801F7	1.87e-176	501	427	0.592	0.578	WN10B_DANRE Protein Wnt-10b OS=Danio rerio OX=7955 GN=wnt10b PE=2 SV=1
5	P48614	8.93e-170	482	389	0.564	0.604	WN10B_MOUSE Protein Wnt-10b OS=Mus musculus OX=10090 GN=Wnt10b PE=2 SV=1
6	O00744	1.37e-169	482	389	0.566	0.607	WN10B_HUMAN Protein Wnt-10b OS=Homo sapiens OX=9606 GN=WNT10B PE=1 SV=2
7	Q9DEB8	8.33e-91	280	349	0.353	0.421	Q9DEB8_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT7A PE=2 SV=1
8	Q98SN7	1.14e-90	281	385	0.374	0.405	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
9	Q93097	2.99e-88	275	391	0.355	0.379	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
10	A0A0G2K3B7	4.62e-88	273	353	0.372	0.439	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
11	Q3L254	6.78e-88	272	349	0.345	0.413	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
12	P28047	7.40e-88	272	349	0.357	0.427	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
13	Q5NSW6	7.40e-88	272	349	0.357	0.427	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1
14	Q8AY89	1.03e-87	273	387	0.355	0.382	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
15	O70283	1.46e-87	273	389	0.355	0.380	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
16	P56706	1.89e-87	271	349	0.355	0.424	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
17	P49337	2.73e-87	271	351	0.355	0.422	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
18	P49338	3.17e-87	271	351	0.355	0.422	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
19	P22724	3.38e-87	271	351	0.360	0.427	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
20	P56705	4.43e-87	270	351	0.357	0.425	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05505 Ebola_NP	7.1e+02	9.9	Ebola nucleoprotein
2	PF00110 wnt	4.9e-118	405.7	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010358561.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010359407.1	0.901	Belongs to the membrane-bound acyltransferase family.
2	61622.XP_010384367.1	0.862	Belongs to the G-protein coupled receptor Fz/Smo family.
3	61622.XP_010352954.1	0.854	Frizzled-1
4	61622.XP_010387843.1	0.853	Secreted frizzled-related protein 5
5	61622.XP_010381195.1	0.852	Secreted frizzled-related protein 2
6	61622.XP_010352284.1	0.847	Belongs to the G-protein coupled receptor Fz/Smo family.
7	61622.XP_010354330.1	0.845	Belongs to the G-protein coupled receptor Fz/Smo family.
8	61622.XP_010352827.1	0.844	Belongs to the G-protein coupled receptor Fz/Smo family.
9	61622.XP_010352909.1	0.844	Secreted frizzled-related protein 1
10	61622.XP_010364779.1	0.839	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
11	61622.XP_010369300.1	0.838	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
12	61622.XP_010385200.1	0.834	Belongs to the G-protein coupled receptor Fz/Smo family.
13	61622.XP_010380021.1	0.833	Secreted frizzled-related protein 4
14	61622.XP_010385756.1	0.833	Belongs to the G-protein coupled receptor Fz/Smo family.
15	61622.XP_010369211.1	0.832	Belongs to the G-protein coupled receptor Fz/Smo family.
16	61622.XP_010385211.1	0.829	Wnt inhibitory factor 1
17	61622.XP_010355368.1	0.825	Wntless Wnt ligand secretion mediator
18	61622.XP_010353283.1	0.823	Belongs to the G-protein coupled receptor Fz/Smo family.
19	61622.XP_010379901.1	0.807	Dickkopf WNT signaling pathway inhibitor 1
20	61622.XP_010366337.1	0.800	Dickkopf WNT signaling pathway inhibitor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.996	receptor ligand activity
GO:0005109	0.448	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0032502	0.996	developmental process
GO:0065007	0.995	biological regulation
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.994	anatomical structure development
GO:0050896	0.992	response to stimulus
GO:0050794	0.992	regulation of cellular process
GO:0023052	0.988	signaling
GO:0007154	0.988	cell communication
GO:0016055	0.975	Wnt signaling pathway
GO:0048513	0.956	animal organ development
GO:0048518	0.927	positive regulation of biological process
GO:0007275	0.915	multicellular organism development
GO:0009888	0.907	tissue development
GO:0060070	0.902	canonical Wnt signaling pathway
GO:0009653	0.893	anatomical structure morphogenesis
GO:0030154	0.890	cell differentiation
GO:0048731	0.875	system development
GO:0019222	0.843	regulation of metabolic process
GO:0060255	0.831	regulation of macromolecule metabolic process
GO:0048522	0.804	positive regulation of cellular process
GO:0009887	0.791	animal organ morphogenesis
GO:0042476	0.775	odontogenesis
GO:0008544	0.769	epidermis development
GO:0010468	0.752	regulation of gene expression
GO:0043588	0.741	skin development
GO:0009719	0.699	response to endogenous stimulus
GO:0048519	0.696	negative regulation of biological process
GO:0010604	0.696	positive regulation of macromolecule metabolic process
GO:0042303	0.695	molting cycle
GO:0080090	0.667	regulation of primary metabolic process
GO:0051171	0.662	regulation of nitrogen compound metabolic process
GO:0048523	0.632	negative regulation of cellular process
GO:0031323	0.615	regulation of cellular metabolic process
GO:0060429	0.611	epithelium development
GO:0050793	0.591	regulation of developmental process
GO:0010646	0.537	regulation of cell communication
GO:0071495	0.531	cellular response to endogenous stimulus
GO:0048583	0.518	regulation of response to stimulus
GO:0023051	0.508	regulation of signaling
GO:0048729	0.504	tissue morphogenesis
GO:0010556	0.502	regulation of macromolecule biosynthetic process
GO:0002009	0.484	morphogenesis of an epithelium
GO:0009966	0.477	regulation of signal transduction
GO:0019219	0.467	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.456	regulation of RNA metabolic process
GO:0031326	0.455	regulation of cellular biosynthetic process
GO:0022404	0.438	molting cycle process
GO:0051173	0.420	positive regulation of nitrogen compound metabolic process
GO:0006355	0.402	regulation of DNA-templated transcription
GO:0031325	0.331	positive regulation of cellular metabolic process
GO:0030111	0.318	regulation of Wnt signaling pathway
GO:0042127	0.316	regulation of cell population proliferation
GO:0051239	0.314	regulation of multicellular organismal process
GO:0007399	0.309	nervous system development
GO:0009891	0.308	positive regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0071944	0.941	cell periphery
GO:0005622	0.918	intracellular anatomical structure
GO:0043226	0.781	organelle
GO:0043231	0.767	intracellular membrane-bounded organelle
GO:0005737	0.703	cytoplasm
GO:0012505	0.636	endomembrane system
GO:0070013	0.581	intracellular organelle lumen
GO:0016020	0.325	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]