StarFunc result for job id Q9GZT6

User Input

>input (254 residues)
MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRREFFTTTTKEGYDRRPVDITPLEQRKLT
FDTHALVQDLETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLD
AIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDM
FTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVF
TCLAIALGFYRFWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZT6	1.000	1.000	1.175E-33	254	1.000	1.000	Q9GZT6.pdb.gz	CC90B_HUMAN Coiled-coil domain-containing protein 90B, mitochondrial OS=Homo sapiens OX=9606 GN=CCDC90B PE=1 SV=2
2	AFDB:Q8C3X2	0.754	0.748	1.127E-26	256	0.870	0.863	Q8C3X2.pdb.gz	CC90B_MOUSE Coiled-coil domain-containing protein 90B, mitochondrial OS=Mus musculus OX=10090 GN=Ccdc90b PE=1 SV=1
3	AFDB:E9PKQ5	0.598	0.717	1.052E-21	208	0.626	0.764	E9PKQ5.pdb.gz	E9PKQ5_HUMAN Coiled-coil domain containing 90B OS=Homo sapiens OX=9606 GN=CCDC90B PE=1 SV=1
4	AFDB:Q96AQ8	0.559	0.423	3.584E-16	359	0.488	0.345	Q96AQ8.pdb.gz	MCUR1_HUMAN Mitochondrial calcium uniporter regulator 1 OS=Homo sapiens OX=9606 GN=MCUR1 PE=1 SV=1
5	AFDB:Q9SIV6	0.537	0.591	7.894E-8	230	0.248	0.274	Q9SIV6.pdb.gz	Q9SIV6_ARATH Coiled-coil 90B-like protein (DUF1640) OS=Arabidopsis thaliana OX=3702 GN=At2g16460 PE=1 SV=2
6	AFDB:O14042	0.448	0.519	2.253E-5	216	0.161	0.190	O14042.pdb.gz	FMP32_SCHPO Protein fmp32, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fmp32 PE=3 SV=1
7	AFDB:P43557	0.455	0.552	1.080E-4	207	0.205	0.251	P43557.pdb.gz	FMP32_YEAST Protein FMP32, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP32 PE=1 SV=1
8	AFDB:O42997	0.448	0.394	7.784E-4	290	0.138	0.121	O42997.pdb.gz	YBC7_SCHPO Uncharacterized protein C27B12.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi071 PE=4 SV=1
9	AFDB:Q10073	0.436	0.518	9.042E-3	211	0.161	0.194	Q10073.pdb.gz	YAN8_SCHPO Uncharacterized CCDC90 family protein C3H1.08c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H1.08c PE=3 SV=1
10	AFDB:Q8TFH5	0.255	0.311	2.918E-1	203	0.091	0.113	Q8TFH5.pdb.gz	YIK9_SCHPO Meiotically up-regulated protein PB17E12.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB17E12.09 PE=4 SV=1
11	PDB:1vddA	0.098	0.124	1.537	199	0.043	0.055	1vddA.pdb.gz	Ring-shaped architecture of RecR: implications for its role in homologous recombinational DNA repair
12	PDB:7ajtCL	0.166	0.063	2.160	781	0.055	0.018	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:1tj7A	0.122	0.071	2.312	455	0.028	0.015	1tj7A.pdb.gz	Structure determination and refinement at 2.44 A resolution of argininosuccinate lyase from Escherichia coli.
14	PDB:7ktrH	0.108	0.230	2.312	99	0.051	0.131	7ktrH.pdb.gz	Structure of the human SAGA coactivator complex.
15	PDB:1y11A	0.131	0.097	2.476	364	0.047	0.033	1y11A.pdb.gz
16	PDB:1rykA	0.095	0.335	2.650	69	0.035	0.130	1rykA.pdb.gz
17	PDB:4yewC	0.129	0.407	2.650	71	0.035	0.127	4yewC.pdb.gz	HU multimerization shift controls nucleoid compaction.
18	PDB:3av0A	0.103	0.072	2.837	369	0.039	0.027	3av0A.pdb.gz	Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
19	PDB:1c7yA	0.098	0.125	3.251	199	0.024	0.030	1c7yA.pdb.gz	Crystal structure of the holliday junction DNA in complex with a single RuvA tetramer.
20	PDB:4wlwA	0.097	0.188	3.251	130	0.031	0.062	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZT6	0.0	523	254	1.000	1.000	CC90B_HUMAN Coiled-coil domain-containing protein 90B, mitochondrial OS=Homo sapiens OX=9606 GN=CCDC90B PE=1 SV=2
2	Q8C3X2	4.97e-161	448	256	0.870	0.863	CC90B_MOUSE Coiled-coil domain-containing protein 90B, mitochondrial OS=Mus musculus OX=10090 GN=Ccdc90b PE=1 SV=1
3	E9PKQ5	1.23e-113	326	208	0.614	0.750	E9PKQ5_HUMAN Coiled-coil domain containing 90B OS=Homo sapiens OX=9606 GN=CCDC90B PE=1 SV=1
4	Q96AQ8	1.30e-76	238	359	0.488	0.345	MCUR1_HUMAN Mitochondrial calcium uniporter regulator 1 OS=Homo sapiens OX=9606 GN=MCUR1 PE=1 SV=1
5	Q9SIV6	1.84e-21	91.7	230	0.276	0.304	Q9SIV6_ARATH Coiled-coil 90B-like protein (DUF1640) OS=Arabidopsis thaliana OX=3702 GN=At2g16460 PE=1 SV=2
6	P43557	1.36e-09	58.5	207	0.197	0.242	FMP32_YEAST Protein FMP32, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP32 PE=1 SV=1
7	Q10073	2.56e-06	49.3	211	0.138	0.166	YAN8_SCHPO Uncharacterized CCDC90 family protein C3H1.08c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H1.08c PE=3 SV=1
8	O14042	7.02e-04	42.0	216	0.154	0.181	FMP32_SCHPO Protein fmp32, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fmp32 PE=3 SV=1
9	A0A8I5ZQ25	0.10	36.2	1834	0.150	0.021	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
10	A0A8I5ZVQ5	0.10	36.2	1741	0.150	0.022	A0A8I5ZVQ5_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
11	A0A8I6A3T2	0.10	36.2	1792	0.150	0.021	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
12	D3ZQN7	0.10	36.2	1786	0.150	0.021	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
13	Q5RH53	0.22	35.0	480	0.102	0.054	Q5RH53_DANRE Angiopoietin-like 1a OS=Danio rerio OX=7955 GN=angptl1 PE=4 SV=1
14	Q5KQU0	0.23	35.0	480	0.102	0.054	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
15	P02469	0.24	35.4	1786	0.146	0.021	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3
16	O95841	0.85	33.1	491	0.114	0.059	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
17	Q640P2	0.88	33.1	490	0.114	0.059	ANGL1_MOUSE Angiopoietin-related protein 1 OS=Mus musculus OX=10090 GN=Angptl1 PE=2 SV=1
18	A0A0R4IVY5	1.5	32.7	1359	0.122	0.023	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
19	P07942	2.1	32.3	1786	0.134	0.019	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
20	F1MNT4	2.3	32.0	1786	0.134	0.019	F1MNT4_BOVIN Laminin subunit beta 1 OS=Bos taurus OX=9913 GN=LAMB1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07798 CCDC90-like	4.2e-53	191.4	Coiled-coil domain-containing protein 90-like
2	PF02346 Vac_Fusion	3.3e+02	12.3	Chordopoxvirus multifunctional envelope protein A27

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434724

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356476	0.785	TRMT1-like protein
2	9606.ENSP00000377051	0.763	Ankyrin repeat domain-containing protein 42
3	9606.ENSP00000258105	0.729	Mitochondrial ribosomal protein L53
4	9606.ENSP00000350869	0.710	Zinc finger protein 346
5	9606.ENSP00000339256	0.672	NIPA-like protein 2
6	9606.ENSP00000368468	0.672	Mitochondrial calcium uniporter regulator 1
7	9606.ENSP00000393316	0.670	Thioredoxin-related transmembrane protein 1
8	9606.ENSP00000432119	0.660	WD repeat-containing protein 74
9	9606.ENSP00000357345	0.619	Dual specificity protein kinase CLK2
10	9606.ENSP00000268802	0.618	RNA-binding protein NOB1
11	9606.ENSP00000351737	0.586	Complex I assembly factor TMEM126B, mitochondrial
12	9606.ENSP00000435189	0.583	Ras-related protein Rab-30
13	9606.ENSP00000298281	0.582	Pre-mRNA cleavage complex 2 protein Pcf11
14	9606.ENSP00000346280	0.561	tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like
15	9606.ENSP00000325421	0.544	Presenilins-associated rhomboid-like protein, mitochondrial
16	9606.ENSP00000367638	0.530	Rho guanine nucleotide exchange factor 39
17	9606.ENSP00000421191	0.520	Immunoglobulin superfamily, member 22
18	9606.ENSP00000370419	0.508	Tetratricopeptide repeat domain containing
19	9606.ENSP00000305204	0.501	Cytoskeleton-associated protein 2-like
20	9606.ENSP00000354451	0.500	Ras GTPase-activating-like protein IQGAP3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.359	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0051179	0.642	localization
GO:0071840	0.548	cellular component organization or biogenesis
GO:0051234	0.548	establishment of localization
GO:0016043	0.459	cellular component organization
GO:0006810	0.372	transport
GO:0098662	0.338	inorganic cation transmembrane transport
GO:0098655	0.338	monoatomic cation transmembrane transport
GO:1990542	0.330	mitochondrial transmembrane transport
GO:0055074	0.330	calcium ion homeostasis
GO:0030003	0.327	intracellular monoatomic cation homeostasis
GO:0006874	0.319	intracellular calcium ion homeostasis
GO:0006851	0.307	mitochondrial calcium ion transmembrane transport
GO:0051560	0.303	mitochondrial calcium ion homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]