StarFunc result for job id Q9GZT8

User Input

>input (377 residues)
MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSP
PHTVNTLFLTNDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENR
VGIYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLD
KVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSL
EKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRLALGVGRTLESQVKVVALCAG
SGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDLRDMLDSHLEN
KINIILSETDRDPLQVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZT8	1.000	1.000	3.654E-83	377	1.000	1.000	Q9GZT8.pdb.gz	NIF3L_HUMAN NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1 PE=1 SV=2
2	AFDB:Q9EQ80	0.931	0.934	7.964E-74	376	0.844	0.846	Q9EQ80.pdb.gz	NIF3L_MOUSE NIF3-like protein 1 OS=Mus musculus OX=10090 GN=Nif3l1 PE=1 SV=4
3	AFDB:Q9NK57	0.685	0.878	9.403E-35	292	0.313	0.404	Q9NK57.pdb.gz	NIF3L_DROME NIF3-like protein 1 OS=Drosophila melanogaster OX=7227 GN=anon-35F/36A PE=1 SV=3
4	AFDB:Q384V6	0.662	0.884	1.061E-32	281	0.289	0.388	Q384V6.pdb.gz	Q384V6_TRYB2 NGG1 interacting factor 3-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5000 PE=3 SV=1
5	AFDB:P53081	0.631	0.819	1.519E-28	288	0.255	0.333	P53081.pdb.gz	NIF3_YEAST NGG1-interacting factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIF3 PE=1 SV=1
6	AFDB:O94404	0.635	0.857	2.168E-27	278	0.289	0.392	O94404.pdb.gz	NIF3_SCHPO Protein NIF3 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC126.12 PE=3 SV=1
7	PDB:1nmoA	0.573	0.855	3.922E-14	247	0.167	0.255	1nmoA.pdb.gz	Crystal Structure of Escherichia coli Protein ybgI, a toroidal structure with a dinuclear metal site
8	AFDB:P0AFP6	0.571	0.852	4.749E-14	247	0.162	0.247	P0AFP6.pdb.gz	GCH1L_ECOLI GTP cyclohydrolase 1 type 2 homolog OS=Escherichia coli (strain K12) OX=83333 GN=ybgI PE=1 SV=1
9	PDB:1sc6D	0.155	0.152	7.168E-4	384	0.069	0.068	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase
10	PDB:2p9eA	0.163	0.153	1.373E-3	406	0.037	0.034	2p9eA.pdb.gz	The Effect of Hinge Mutations on Effector Binding and Domain Rotation in Escherichia coli D-3-Phosphoglycerate Dehydrogenase
11	AFDB:P9WH31	0.156	0.463	3.001E-3	96	0.034	0.135	P9WH31.pdb.gz	RS6_MYCTU Small ribosomal subunit protein bS6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpsF PE=1 SV=1
12	AFDB:P40054	0.169	0.139	3.183E-3	469	0.064	0.051	P40054.pdb.gz	SERA_YEAST D-3-phosphoglycerate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SER3 PE=1 SV=1
13	AFDB:Q6FIP3	0.169	0.140	3.377E-3	466	0.066	0.054	Q6FIP3.pdb.gz	Q6FIP3_CANGA phosphoglycerate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M12837g PE=3 SV=1
14	PDB:2j9dB	0.166	0.511	4.218E-3	103	0.042	0.155	2j9dB.pdb.gz	Structure of Glnk1 with Bound Effectors Indicates Regulatory Mechanism for Ammonia Uptake.
15	PDB:7kgbf	0.163	0.491	4.218E-3	95	0.037	0.147	7kgbf.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
16	PDB:1gnkA	0.164	0.530	4.474E-3	98	0.048	0.184	1gnkA.pdb.gz
17	PDB:4c3kD	0.141	0.376	7.177E-3	101	0.034	0.129	4c3kD.pdb.gz	Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
18	PDB:2j9eB	0.159	0.416	1.023E-2	119	0.048	0.151	2j9eB.pdb.gz	Structure of Glnk1 with Bound Effectors Indicates Regulatory Mechanism for Ammonia Uptake.
19	PDB:3lf0A	0.144	0.419	1.023E-2	99	0.032	0.121	3lf0A.pdb.gz	Crystal structures of the apo and ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein.
20	PDB:2ns1B	0.154	0.453	1.151E-2	113	0.048	0.159	2ns1B.pdb.gz	Inhibitory complex of the transmembrane ammonia channel, AmtB, and the cytosolic regulatory protein, GlnK, at 1.96

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EQ80	0.0	659	376	0.844	0.846	NIF3L_MOUSE NIF3-like protein 1 OS=Mus musculus OX=10090 GN=Nif3l1 PE=1 SV=4
2	Q9GZT8	0.0	780	377	1.000	1.000	NIF3L_HUMAN NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1 PE=1 SV=2
3	Q9NK57	8.23e-42	150	292	0.218	0.281	NIF3L_DROME NIF3-like protein 1 OS=Drosophila melanogaster OX=7227 GN=anon-35F/36A PE=1 SV=3
4	Q384V6	8.39e-26	107	281	0.143	0.192	Q384V6_TRYB2 NGG1 interacting factor 3-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5000 PE=3 SV=1
5	O94404	2.95e-25	105	278	0.149	0.201	NIF3_SCHPO Protein NIF3 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC126.12 PE=3 SV=1
6	P53081	3.24e-22	97.4	288	0.141	0.184	NIF3_YEAST NGG1-interacting factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIF3 PE=1 SV=1
7	P0AFP6	0.001	42.7	247	0.072	0.109	GCH1L_ECOLI GTP cyclohydrolase 1 type 2 homolog OS=Escherichia coli (strain K12) OX=83333 GN=ybgI PE=1 SV=1
8	Q382Q5	2.1	32.3	260	0.061	0.088	Q382Q5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4610 PE=4 SV=1
9	Q8H1F9	9.0	30.8	467	0.066	0.054	PCH2_ARATH Pachytene checkpoint protein 2 homolog OS=Arabidopsis thaliana OX=3702 GN=PCH2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01784 NIF3	2.9e-75	264.6	NIF3 (NGG1p interacting factor 3)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386394

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295899	0.934	THO complex subunit 7 homolog
2	9606.ENSP00000299259	0.864	COP9 signalosome complex subunit 2
3	9606.ENSP00000409171	0.851	Plexin-B2
4	9606.ENSP00000366565	0.841	Vacuolar protein sorting-associated protein 28 homolog
5	9606.ENSP00000320886	0.770	Carbohydrate-responsive element-binding protein
6	9606.ENSP00000246912	0.764	Max-like protein X
7	9606.ENSP00000337889	0.764	Max dimerization protein 4
8	9606.ENSP00000393667	0.695	Protein FAM126B
9	9606.ENSP00000267202	0.682	Vacuolar protein sorting-associated protein 37B
10	9606.ENSP00000251968	0.681	Tumor susceptibility gene 101 protein
11	9606.ENSP00000339933	0.671	Pyruvate kinase PKLR
12	9606.ENSP00000286175	0.670	Peptidyl-prolyl cis-trans isomerase
13	9606.ENSP00000358327	0.665	Caspase-7
14	9606.ENSP00000174618	0.648	Max-binding protein MNT
15	9606.ENSP00000264276	0.630	Alsin
16	9606.ENSP00000350409	0.626	Protein unc-50 homolog
17	9606.ENSP00000321703	0.608	Transforming acidic coiled-coil-containing protein 1
18	9606.ENSP00000448054	0.599	Nucleoporin Nup37
19	9606.ENSP00000333568	0.593	Serine/threonine-protein kinase D1
20	9606.ENSP00000394316	0.577	Basic leucine zipper and W2 domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.995	identical protein binding
GO:0140297	0.937	DNA-binding transcription factor binding
GO:0061629	0.886	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.981	regulation of biological process
GO:0050794	0.960	regulation of cellular process
GO:0048522	0.949	positive regulation of cellular process
GO:0080090	0.915	regulation of primary metabolic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0031323	0.910	regulation of cellular metabolic process
GO:0060255	0.895	regulation of macromolecule metabolic process
GO:0009893	0.853	positive regulation of metabolic process
GO:0019219	0.848	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.837	positive regulation of cellular metabolic process
GO:0010556	0.829	regulation of macromolecule biosynthetic process
GO:0009987	0.816	cellular process
GO:1903506	0.809	regulation of nucleic acid-templated transcription
GO:0051173	0.802	positive regulation of nitrogen compound metabolic process
GO:0010604	0.791	positive regulation of macromolecule metabolic process
GO:0010468	0.739	regulation of gene expression
GO:0009891	0.730	positive regulation of biosynthetic process
GO:0006355	0.716	regulation of DNA-templated transcription
GO:0010557	0.634	positive regulation of macromolecule biosynthetic process
GO:0031328	0.631	positive regulation of cellular biosynthetic process
GO:0045935	0.594	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.482	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.992	nucleus
GO:0005739	0.667	mitochondrion
GO:0070013	0.531	intracellular organelle lumen
GO:0005829	0.428	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]