StarFunc result for job id Q9GZT9

User Input

>input (426 residues)
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZT9	1.000	1.000	3.055E-81	426	1.000	1.000	Q9GZT9.pdb.gz	EGLN1_HUMAN Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 PE=1 SV=1
2	AFDB:Q91YE3	0.591	0.624	2.225E-64	400	0.772	0.823	Q91YE3.pdb.gz	EGLN1_MOUSE Egl nine homolog 1 OS=Mus musculus OX=10090 GN=Egln1 PE=1 SV=2
3	AFDB:Q6AYU4	0.516	0.529	1.456E-39	415	0.423	0.434	Q6AYU4.pdb.gz	EGLN2_RAT Prolyl hydroxylase EGLN2 OS=Rattus norvegicus OX=10116 GN=Egln2 PE=1 SV=1
4	AFDB:Q8SX21	0.470	0.419	2.357E-35	478	0.376	0.335	Q8SX21.pdb.gz	Q8SX21_DROME HIF prolyl hydroxylase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
5	AFDB:F8W1G2	0.255	0.749	1.689E-19	145	0.214	0.628	F8W1G2.pdb.gz	F8W1G2_HUMAN Egl-9 family hypoxia inducible factor 3 OS=Homo sapiens OX=9606 GN=EGLN3 PE=1 SV=1
6	PDB:4nhyA	0.326	0.303	1.749E-9	461	0.087	0.080	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
7	PDB:3kt4A	0.351	0.274	5.502E-8	563	0.096	0.073	3kt4A.pdb.gz	Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
8	PDB:3mguA	0.336	0.275	5.839E-8	533	0.096	0.077	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
9	PDB:5gjaA	0.316	0.431	5.592E-7	299	0.066	0.094	5gjaA.pdb.gz	Pyrazinamide and derivatives block ethylene biosynthesis by inhibiting ACC oxidase.
10	PDB:7etlA	0.334	0.465	5.935E-7	294	0.045	0.065	7etlA.pdb.gz	Structural Insight into the Catalytic Mechanism of the Endoperoxide Synthase FtmOx1.
11	PDB:6ku3B	0.338	0.437	8.999E-7	318	0.063	0.085	6ku3B.pdb.gz	A common allosteric mechanism regulates homeostatic inactivation of auxin and gibberellin.
12	PDB:4qkbA	0.300	0.602	1.076E-6	190	0.061	0.137	4qkbA.pdb.gz	The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism
13	PDB:5o7yA	0.332	0.386	1.286E-6	358	0.085	0.101	5o7yA.pdb.gz
14	PDB:3obzA	0.307	0.436	1.731E-6	290	0.094	0.138	3obzA.pdb.gz	Crystal Structure of Human PHYHD1, a Non-Heme Fe(II) and 2-Oxoglutarate Dependent Oxygenase Related to Phytanoyl-CoA Hydroxylase
15	PDB:4ie6A	0.318	0.304	2.785E-6	447	0.073	0.069	4ie6A.pdb.gz	Structural basis for inhibition of the fat mass and obesity associated protein (FTO)
16	AFDB:Q9USR9	0.210	0.146	3.472E-4	643	0.110	0.073	Q9USR9.pdb.gz	CENPC_SCHPO Inner kinetochore subunit cnp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnp3 PE=1 SV=2
17	AFDB:P43026	0.104	0.094	4.960E-4	501	0.141	0.120	P43026.pdb.gz	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
18	AFDB:P35201	0.157	0.126	1.629E-3	549	0.129	0.100	P35201.pdb.gz	CENPC_YEAST Inner kinetochore subunit MIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIF2 PE=1 SV=1
19	AFDB:A0A0B4K7C1	0.287	0.164	5.351E-3	803	0.073	0.039	A0A0B4K7C1.pdb.gz	A0A0B4K7C1_DROME Aspartyl beta-hydroxylase, isoform H OS=Drosophila melanogaster OX=7227 GN=Asph PE=1 SV=1
20	AFDB:A0A0G2K6D0	0.225	0.082	1.230E-2	1366	0.148	0.046	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59722	0.0	528	338	0.606	0.763	EGLN1_RAT Egl nine homolog 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Egln1 PE=2 SV=2
2	Q91YE3	0.0	634	400	0.784	0.835	EGLN1_MOUSE Egl nine homolog 1 OS=Mus musculus OX=10090 GN=Egln1 PE=1 SV=2
3	Q9GZT9	0.0	879	426	1.000	1.000	EGLN1_HUMAN Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 PE=1 SV=1
4	Q96KS0	7.03e-113	338	407	0.362	0.378	EGLN2_HUMAN Prolyl hydroxylase EGLN2 OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=1
5	Q6AYU4	1.04e-111	336	415	0.359	0.369	EGLN2_RAT Prolyl hydroxylase EGLN2 OS=Rattus norvegicus OX=10116 GN=Egln2 PE=1 SV=1
6	Q9H6Z9	1.19e-105	314	239	0.338	0.603	EGLN3_HUMAN Prolyl hydroxylase EGLN3 OS=Homo sapiens OX=9606 GN=EGLN3 PE=1 SV=1
7	Q91UZ4	8.51e-105	312	239	0.333	0.594	EGLN3_MOUSE Prolyl hydroxylase EGLN3 OS=Mus musculus OX=10090 GN=Egln3 PE=1 SV=1
8	Q62630	2.18e-103	308	239	0.331	0.590	EGLN3_RAT Prolyl hydroxylase EGLN3 OS=Rattus norvegicus OX=10116 GN=Egln3 PE=1 SV=2
9	Q8SX21	1.61e-88	278	478	0.369	0.328	Q8SX21_DROME HIF prolyl hydroxylase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
10	Q9VN98	4.53e-83	259	325	0.286	0.375	Q9VN98_DROME GH23732p OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
11	Q8I0C2	5.15e-83	258	278	0.284	0.435	Q8I0C2_DROME HIF prolyl hydroxylase, isoform B OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
12	F8W1G2	2.05e-65	207	145	0.214	0.628	F8W1G2_HUMAN Egl-9 family hypoxia inducible factor 3 OS=Homo sapiens OX=9606 GN=EGLN3 PE=1 SV=1
13	G5EBV0	4.25e-62	215	723	0.232	0.137	EGL9_CAEEL Hypoxia-inducible factor prolyl hydroxylase OS=Caenorhabditis elegans OX=6239 GN=egl-9 PE=1 SV=1
14	Q86KR9	1.17e-12	70.1	284	0.141	0.211	P4HA_DICDI Prolyl 4-hydroxylase subunit alpha OS=Dictyostelium discoideum OX=44689 GN=phyA PE=1 SV=1
15	Q8R5A0	4.58e-04	44.7	433	0.054	0.053	SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus OX=10090 GN=Smyd2 PE=1 SV=1
16	Q1MTH6	6.91e-04	43.9	358	0.110	0.131	Q1MTH6_DANRE Programmed cell death 2 OS=Danio rerio OX=7955 GN=zgc:63685 PE=1 SV=1
17	Q9NRG4	7.16e-04	43.9	433	0.045	0.044	SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2 PE=1 SV=2
18	Q7M6Z3	0.001	43.1	433	0.045	0.044	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
19	Q99MV1	0.001	43.5	1172	0.040	0.015	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
20	Q9BXT4	0.001	43.9	1180	0.040	0.014	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13640 2OG-FeII_Oxy_3	7.8e-17	73.3	2OG-Fe(II) oxygenase superfamily
2	PF13661 2OG-FeII_Oxy_4	3.3e-06	38.8	2OG-Fe(II) oxygenase superfamily
3	PF13824 zf-Mss51	1e+02	14.4	Zinc-finger of mitochondrial splicing suppressor 51
4	PF01753 zf-MYND	8.8e-07	40.2	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355601

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437955	0.999	Hypoxia-inducible factor 1-alpha
2	9606.ENSP00000263734	0.998	Endothelial PAS domain-containing protein 1
3	9606.ENSP00000256474	0.990	Von Hippel-Lindau disease tumor suppressor
4	9606.ENSP00000273317	0.988	LIM domain-containing protein 1
5	9606.ENSP00000476767	0.976	Peptidyl-prolyl cis-trans isomerase FKBP8
6	9606.ENSP00000318165	0.968	Protein OS-9
7	9606.ENSP00000380024	0.965	Inhibitor of growth protein 4
8	9606.ENSP00000335153	0.962	Heat shock protein HSP 90-alpha
9	9606.ENSP00000482075	0.911	Prostaglandin E synthase 3
10	9606.ENSP00000363019	0.908	Ubiquitin-conjugating enzyme E2 D1
11	9606.ENSP00000469686	0.908	Egl nine homolog 2
12	9606.ENSP00000381717	0.905	Ubiquitin-conjugating enzyme E2 D2
13	9606.ENSP00000349722	0.901	Ubiquitin conjugating enzyme E2 D3
14	9606.ENSP00000291582	0.881	Autoimmune regulator
15	9606.ENSP00000366898	0.871	Hypoxia-inducible factor 3-alpha
16	9606.ENSP00000476960	0.869	Histone cluster 2 H3 pseudogene 2
17	9606.ENSP00000478121	0.859	Elongin-C
18	9606.ENSP00000250457	0.856	Egl nine homolog 3
19	9606.ENSP00000262306	0.839	Elongin-B
20	9606.ENSP00000444856	0.833	Cullin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008198	0.999	ferrous iron binding
GO:0031545	0.999	peptidyl-proline 4-dioxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0050789	0.995	regulation of biological process
GO:0044238	0.995	primary metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0006807	0.991	nitrogen compound metabolic process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0036211	0.980	protein modification process
GO:0006950	0.959	response to stress
GO:0019219	0.928	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.921	regulation of gene expression
GO:0070482	0.915	response to oxygen levels
GO:0009889	0.895	regulation of biosynthetic process
GO:0031326	0.894	regulation of cellular biosynthetic process
GO:0018193	0.893	peptidyl-amino acid modification
GO:0051252	0.890	regulation of RNA metabolic process
GO:0010556	0.889	regulation of macromolecule biosynthetic process
GO:0006355	0.883	regulation of DNA-templated transcription
GO:0018126	0.841	protein hydroxylation
GO:0009987	0.810	cellular process
GO:0018208	0.807	peptidyl-proline modification
GO:0042221	0.802	response to chemical
GO:0065009	0.798	regulation of molecular function
GO:0036293	0.669	response to decreased oxygen levels
GO:0001666	0.570	response to hypoxia
GO:0048518	0.550	positive regulation of biological process
GO:0051090	0.378	regulation of DNA-binding transcription factor activity
GO:0051716	0.346	cellular response to stimulus
GO:0048522	0.340	positive regulation of cellular process
GO:0042592	0.335	homeostatic process
GO:0009893	0.332	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043227	0.946	membrane-bounded organelle
GO:0005634	0.882	nucleus
GO:0031981	0.778	nuclear lumen
GO:0005654	0.529	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]