StarFunc result for job id Q9GZU2

User Input

>input (1588 residues)
MLPPKHLSATKPKKSWAPNLYELDSDLTKEPDVIIGEGPTDSEFFHQRFRNLIYVEFVGP
RKTLIKLRNLCLDWLQPETRTKEEIIELLVLEQYLTIIPEKLKPWVRAKKPENCEKLVTL
LENYKEMYQPEDDNNSDVTSDDDMTRNRRESSPPHSVHSFSDRDWDRRGRSRDMEPRDRW
SHTRNPRSRMPPRDLSLPVVAKTSFEMDREDDRDSRAYESRSQDAESYQNVVDLAEDRKP
HNTIQDNMENYRKLLSLVQLAEDDGHSHMTQGHSSRSKRSAYPSTSRGLKTMPEAKKSTH
RRGICEDESSHGVIMEKFIKDVSRSSKSGRARESSDRSQRFPRMSDDNWKDISLNKRESV
IQQRVYEGNAFRGGFRFNSTLVSRKRVLERKRRYHFDTDGKGSIHDQKGCPRKKPFECGS
EMRKAMSVSSLSSLSSPSFTESQPIDFGAMPYVCDECGRSFSVISEFVEHQIMHTRENLY
EYGESFIHSVAVSEVQKSQVGGKRFECKDCGETFNKSAALAEHRKIHARGYLVECKNQEC
EEAFMPSPTFSELQKIYGKDKFYECRVCKETFLHSSALIEHQKIHFGDDKDNEREHERER
ERERGETFRPSPALNEFQKMYGKEKMYECKVCGETFLHSSSLKEHQKIHTRGNPFENKGK
VCEETFIPGQSLKRRQKTYNKEKLCDFTDGRDAFMQSSELSEHQKIHSRKNLFEGRGYEK
SVIHSGPFTESQKSHTITRPLESDEDEKAFTISSNPYENQKIPTKENVYEAKSYERSVIH
SLASVEAQKSHSVAGPSKPKVMAESTIQSFDAINHQRVRAGGNTSEGREYSRSVIHSLVA
SKPPRSHNGNELVESNEKGESSIYISDLNDKRQKIPARENPCEGGSKNRNYEDSVIQSVF
RAKPQKSVPGEGSGEFKKDGEFSVPSSNVREYQKARAKKKYIEHRSNETSVIHSLPFGEQ
TFRPRGMLYECQECGECFAHSSDLTEHQKIHDREKPSGSRNYEWSVIRSLAPTDPQTSYA
QEQYAKEQARNKCKDFRQFFATSEDLNTNQKIYDQEKSHGEESQGENTDGEETHSEETHG
QETIEDPVIQGSDMEDPQKDDPDDKIYECEDCGLGFVDLTDLTDHQKVHSRKCLVDSREY
THSVIHTHSISEYQRDYTGEQLYECPKCGESFIHSSFLFEHQRIHEQDQLYSMKGCDDGF
IALLPMKPRRNRAAERNPALAGSAIRCLLCGQGFIHSSALNEHMRLHREDDLLEQSQMAE
EAIIPGLALTEFQRSQTEERLFECAVCGESFVNPAELADHVTVHKNEPYEYGSSYTHTSF
LTEPLKGAIPFYECKDCGKSFIHSTVLTKHKELHLEEEEEDEAAAAAAAAAQEVEANVHV
PQVVLRIQGLNVEAAEPEVEAAEPEVEAAEPEVEAAEPNGEAEGPDGEAAEPIGEAGQPN
GEAEQPNGDADEPDGAGIEDPEERAEEPEGKAEEPEGDADEPDGVGIEDPEEGEDQEIQV
EEPYYDCHECTETFTSSTAFSEHLKTHASMIIFEPANAFGECSGYIERASTSTGGANQAD
EKYFKCDVCGQLFNDRLSLARHQNTHTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAZ2	0.067	0.077	5.876E-12	1276	0.125	0.155	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
2	AFDB:Q9H582	0.049	0.056	2.993E-10	1327	0.125	0.149	Q9H582.pdb.gz	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
3	AFDB:Q8NAP3	0.059	0.068	1.045E-9	1195	0.130	0.173	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
4	AFDB:A0A0R4INF0	0.041	0.042	3.116E-8	1570	0.153	0.155	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
5	AFDB:M9NEG1	0.043	0.055	2.659E-7	1109	0.103	0.148	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
6	AFDB:A0A0B4K7S6	0.041	0.035	3.801E-7	1965	0.130	0.105	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
7	AFDB:Q9VXJ5	0.039	0.044	1.495E-6	1311	0.134	0.162	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
8	AFDB:Q05GC8	0.043	0.054	8.927E-6	1220	0.115	0.150	Q05GC8.pdb.gz	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
9	AFDB:Q6P0N0	0.036	0.045	1.861E-4	1132	0.096	0.135	Q6P0N0.pdb.gz	M18BP_HUMAN Mis18-binding protein 1 OS=Homo sapiens OX=9606 GN=MIS18BP1 PE=1 SV=1
10	AFDB:A0A0K3AUE4	0.036	0.031	3.803E-4	1968	0.131	0.106	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
11	PDB:3w5kB	0.025	0.219	4.695E-2	110	0.016	0.227	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ff79	0.026	0.058	6.848E-1	432	0.013	0.049	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
13	PDB:4z4kA	0.018	0.085	1.576	282	0.009	0.053	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
14	PDB:6ydhA	0.011	0.199	1.885	62	0.009	0.242	6ydhA.pdb.gz
15	PDB:4v6wCW	0.020	0.122	2.392	130	0.013	0.154	4v6wCW.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:3mhhC	0.026	0.237	3.419	93	0.009	0.161	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
17	PDB:5aj0Ao	0.018	0.098	3.419	105	0.008	0.114	5aj0Ao.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:7ena2	0.024	0.063	3.851	385	0.014	0.060	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:5dkaA	0.022	0.208	4.088	96	0.008	0.135	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:6gawAp	0.021	0.091	4.887	190	0.014	0.121	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3URU2	0.0	1572	1571	0.589	0.595	PEG3_MOUSE Paternally-expressed gene 3 protein OS=Mus musculus OX=10090 GN=Peg3 PE=1 SV=1
2	Q9NZV7	5.70e-80	276	527	0.084	0.254	ZIM2_HUMAN Zinc finger imprinted 2 OS=Homo sapiens OX=9606 GN=ZIM2 PE=1 SV=1
3	Q05481	6.71e-78	285	1191	0.170	0.227	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
4	Q9P0L1	4.37e-60	224	754	0.131	0.276	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
5	Q8TAQ5	7.50e-58	216	688	0.096	0.222	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
6	Q7TMN8	1.26e-57	213	578	0.095	0.261	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
7	Q8BLA2	4.81e-57	211	578	0.094	0.260	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
8	P52742	5.71e-57	213	658	0.111	0.267	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	O43309	2.83e-56	209	611	0.113	0.293	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
10	Q5TYW1	9.90e-54	208	1059	0.156	0.233	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
11	Q9UEG4	1.10e-53	206	869	0.127	0.232	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
12	Q9P2J8	5.33e-50	195	865	0.134	0.245	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
13	Q96JF6	1.69e-49	192	807	0.137	0.269	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
14	Q14585	4.91e-47	179	488	0.088	0.285	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
15	Q8TBZ5	1.17e-46	179	544	0.094	0.276	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
16	Q6ECI4	3.30e-45	178	717	0.107	0.237	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
17	Q6ZN57	6.84e-45	172	461	0.084	0.291	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
18	Q8IYB9	7.56e-45	176	648	0.089	0.218	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
19	Q96NL3	1.22e-44	174	588	0.091	0.247	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
20	P0CG24	1.27e-44	169	379	0.072	0.301	ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens OX=9606 GN=ZNF883 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02023 SCAN	3.4e-27	105.4	SCAN domain
2	PF00096 zf-C2H2	2.7e-45	161.5	Zinc finger, C2H2 type
3	PF18868 zf-C2H2_3rep	2.2	20.4	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	2.8e-23	91.6	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	3.9e-06	38.0	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	0.34	22.5	Zinc-finger double-stranded RNA-binding
7	PF13913 zf-C2HC_2	1.5e-06	39.2	zinc-finger of a C2HC-type
8	PF18439 zf_UBZ	0.48	21.4	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.863	TNF receptor-associated factor 2
2	9606.ENSP00000223215	0.807	Mesoderm-specific transcript homolog protein
3	9606.ENSP00000382972	0.797	Small nuclear ribonucleoprotein-associated protein N
4	9606.ENSP00000353734	0.744	Zinc finger protein PLAGL1
5	9606.ENSP00000418944	0.744	Retrotransposon-derived protein PEG10
6	9606.ENSP00000062104	0.697	Neuronatin
7	9606.ENSP00000381793	0.687	Growth factor receptor-bound protein 10
8	9606.ENSP00000391826	0.687	Insulin-like growth factor II
9	9606.ENSP00000360141	0.657	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
10	9606.ENSP00000320488	0.655	Nucleosome assembly protein 1 like 5
11	9606.ENSP00000340292	0.654	Protein delta homolog 1
12	9606.ENSP00000467123	0.640	NACHT, LRR and PYD domains-containing protein 7
13	9606.ENSP00000349437	0.630	Cation-independent mannose-6-phosphate receptor
14	9606.ENSP00000349156	0.629	E3 ubiquitin-protein ligase SIAH1
15	9606.ENSP00000332643	0.627	Necdin
16	9606.ENSP00000398930	0.625	Epsilon-sarcoglycan
17	9606.ENSP00000413720	0.609	Cyclin-dependent kinase inhibitor 1C
18	9606.ENSP00000364524	0.601	Paired box protein Pax-7
19	9606.ENSP00000406084	0.578	WD repeat-containing protein 20
20	9606.ENSP00000254181	0.577	Ubiquitin specific peptidase 29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0003690	0.583	double-stranded DNA binding
GO:1990837	0.536	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.906	regulation of macromolecule metabolic process
GO:0010468	0.904	regulation of gene expression
GO:0051252	0.896	regulation of RNA metabolic process
GO:0010556	0.767	regulation of macromolecule biosynthetic process
GO:0031326	0.765	regulation of cellular biosynthetic process
GO:0006355	0.751	regulation of DNA-templated transcription
GO:0048518	0.714	positive regulation of biological process
GO:0048519	0.669	negative regulation of biological process
GO:0009987	0.661	cellular process
GO:0048523	0.635	negative regulation of cellular process
GO:0048522	0.563	positive regulation of cellular process
GO:0009893	0.383	positive regulation of metabolic process
GO:0010605	0.331	negative regulation of macromolecule metabolic process
GO:0051172	0.322	negative regulation of nitrogen compound metabolic process
GO:0009890	0.314	negative regulation of biosynthetic process
GO:0031324	0.301	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.993	cytoplasm
GO:0070013	0.535	intracellular organelle lumen
GO:0005654	0.474	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]