StarFunc result for job id Q9GZU3

User Input

>input (492 residues)
MGGRRGPNRTSYCRNPLCEPGSSGGSSGSHTSSASVTSVRSRTRSSSGTGLSSPPLATQT
VVPLQHCKIPELPVQASILFELQLFFCQLIALFVHYINIYKTVWWYPPSHPPSHTSLNFH
LIDFNLLMVTTIVLGRRFIGSIVKEASQRGKVSLFRSILLFLTRFTVLTATGWSLCRSLI
HLFRTYSFLNLLFLCYPFGMYIPFLQLNCDLRKTSLFNHMASMGPREAVSGLAKSRDYLL
TLRETWKQHTRQLYGPDAMPTHACCLSPSLIRSEVEFLKMDFNWRMKEVLVSSMLSAYYV
AFVPVWFVKNTHYYDKRWSCELFLLVSISTSVILMQHLLPASYCDLLHKAAAHLGCWQKV
DPALCSNVLQHPWTEECMWPQGVLVKHSKNVYKAVGHYNVAIPSDVSHFRFHFFFSKPLR
ILNILLLLEGAVIVYQLYSLMSSEKWHQTISLALILFSNYYAFFKLLRDRLVLGKAYSYS
ASPQRDLDHRFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZU3	1.000	1.000	1.397E-69	492	1.000	1.000	Q9GZU3.pdb.gz	TM39B_HUMAN Transmembrane protein 39B OS=Homo sapiens OX=9606 GN=TMEM39B PE=1 SV=1
2	AFDB:Q9NV64	0.834	0.840	1.086E-42	488	0.520	0.525	Q9NV64.pdb.gz	TM39A_HUMAN Transmembrane protein 39A OS=Homo sapiens OX=9606 GN=TMEM39A PE=1 SV=1
3	AFDB:A0A024R0W3	0.127	0.125	1.011E-1	506	0.118	0.115	A0A024R0W3.pdb.gz
4	AFDB:Q38B26	0.135	0.122	1.011E-1	576	0.130	0.111	Q38B26.pdb.gz	Q38B26_TRYB2 Amino acid tansporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1170 PE=4 SV=1
5	AFDB:X1WEA3	0.123	0.073	1.668E-1	1034	0.108	0.051	X1WEA3.pdb.gz	X1WEA3_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=ulk2 PE=4 SV=1
6	AFDB:P59438	0.088	0.059	2.001E-1	1126	0.126	0.055	P59438.pdb.gz	HPS5_MOUSE BLOC-2 complex member HPS5 OS=Mus musculus OX=10090 GN=Hps5 PE=1 SV=2
7	PDB:5y50A	0.149	0.158	2.106E-1	448	0.100	0.109	5y50A.pdb.gz
8	AFDB:Q2M3R5	0.109	0.131	3.302E-1	365	0.100	0.134	Q2M3R5.pdb.gz	S35G1_HUMAN Solute carrier family 35 member G1 OS=Homo sapiens OX=9606 GN=SLC35G1 PE=1 SV=1
9	AFDB:O75385	0.154	0.087	3.456E-1	1050	0.079	0.037	O75385.pdb.gz	ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2
10	AFDB:Q17392	0.112	0.074	3.617E-1	840	0.134	0.079	Q17392.pdb.gz	CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans OX=6239 GN=cul-4 PE=1 SV=3
11	AFDB:C9JFV4	0.104	0.056	3.785E-1	1180	0.175	0.073	C9JFV4.pdb.gz	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
12	PDB:7oseA	0.142	0.140	5.478E-1	503	0.108	0.105	7oseA.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
13	PDB:3axyC	0.126	0.223	7.885E-1	235	0.057	0.119	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
14	PDB:7d10A	0.134	0.142	9.461E-1	446	0.083	0.092	7d10A.pdb.gz
15	PDB:7np7D1	0.112	0.113	1.188	485	0.100	0.101	7np7D1.pdb.gz
16	PDB:6r4vC	0.190	0.277	1.243	294	0.098	0.163	6r4vC.pdb.gz	Metal Coordination Is Crucial for Geranylgeranyl Diphosphate Synthase-Bisphosphonate Interactions: A Crystallographic and Computational Analysis.
17	PDB:5yqgC	0.135	0.243	1.301	237	0.045	0.093	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
18	PDB:7p04A	0.142	0.073	1.790	1353	0.081	0.030	7p04A.pdb.gz	Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5.
19	PDB:7fhkA	0.134	0.106	1.960	663	0.108	0.080	7fhkA.pdb.gz	Voltage-gating and cytosolic Ca 2+ activation mechanisms of Arabidopsis two-pore channel AtTPC1.
20	PDB:7f3tA	0.138	0.183	2.051	330	0.085	0.127	7f3tA.pdb.gz	TMEM120A contains a specific coenzyme A-binding site and might not mediate poking- or stretch-induced channel activities in cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZU3	0.0	1013	492	1.000	1.000	TM39B_HUMAN Transmembrane protein 39B OS=Homo sapiens OX=9606 GN=TMEM39B PE=1 SV=1
2	Q9NV64	1.03e-161	469	488	0.512	0.516	TM39A_HUMAN Transmembrane protein 39A OS=Homo sapiens OX=9606 GN=TMEM39A PE=1 SV=1
3	F8VPM9	1.4	34.3	2688	0.030	0.006	F8VPM9_MOUSE Human immunodeficiency virus type I enhancer binding protein 1 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
4	Q03172	1.4	34.3	2688	0.030	0.006	ZEP1_MOUSE Zinc finger protein 40 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
5	Q9C744	3.0	33.1	869	0.030	0.017	AP3D_ARATH AP-3 complex subunit delta OS=Arabidopsis thaliana OX=3702 GN=DELTA-ADR PE=1 SV=1
6	A0A2R8Q922	3.1	32.3	222	0.065	0.144	A0A2R8Q922_DANRE Claudin OS=Danio rerio OX=7955 GN=cldn10l1b PE=3 SV=1
7	Q9P7W6	5.2	32.3	684	0.037	0.026	MLH1_SCHPO Putative MutL protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mlh1 PE=2 SV=1
8	C7DZK3	7.6	32.0	1783	0.026	0.007	CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio OX=7955 GN=col27a1a PE=2 SV=1
9	Q29101	9.2	31.2	382	0.039	0.050	CXA1_PIG Gap junction alpha-1 protein OS=Sus scrofa OX=9823 GN=GJA1 PE=2 SV=2
10	D3ZGX1	9.4	31.6	1517	0.028	0.009	NEXMI_RAT Neurite extension and migration factor OS=Rattus norvegicus OX=10116 GN=Nexmif PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10271 Tmp39	5.9e-198	669.7	Putative transmembrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216214	0.737	Protein FAM118A
2	9606.ENSP00000369291	0.717	LETM1 domain-containing protein LETM2, mitochondrial
3	9606.ENSP00000216085	0.642	Rhomboid domain containing 3
4	9606.ENSP00000302843	0.634	DnaJ heat shock protein family member C18
5	9606.ENSP00000337340	0.617	Mediator of RNA polymerase II transcription subunit 19
6	9606.ENSP00000369674	0.614	B-cell CLL/lymphoma 7 protein family member C
7	9606.ENSP00000342015	0.612	Cytochrome c oxidase assembly protein COX19
8	9606.ENSP00000301159	0.611	Protein lin-37 homolog
9	9606.ENSP00000348565	0.607	Ubiquitin-like modifier-activating enzyme 5
10	9606.ENSP00000317177	0.547	Mitochondrial cardiolipin hydrolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0033043	0.923	regulation of organelle organization
GO:0048518	0.874	positive regulation of biological process
GO:0031323	0.837	regulation of cellular metabolic process
GO:0009987	0.820	cellular process
GO:0050792	0.705	regulation of viral process
GO:0044087	0.617	regulation of cellular component biogenesis
GO:0031324	0.393	negative regulation of cellular metabolic process
GO:0009895	0.353	negative regulation of catabolic process
GO:0031330	0.338	negative regulation of cellular catabolic process
GO:0010506	0.303	regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.998	organelle membrane
GO:0098827	0.996	endoplasmic reticulum subcompartment
GO:0042175	0.995	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.993	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]