StarFunc result for job id Q9GZU7

User Input

>input (261 residues)
MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGA
PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEI
DGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRES
CVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPF
FEQLSRVDDVYSVLRQPRPGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58466	0.942	0.942	3.934E-52	261	0.989	0.989	P58466.pdb.gz	CTDS1_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Mus musculus OX=10090 GN=Ctdsp1 PE=1 SV=1
2	AFDB:O15194	0.703	0.665	1.012E-39	276	0.678	0.641	O15194.pdb.gz	CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens OX=9606 GN=CTDSPL PE=1 SV=2
3	AFDB:Q6P3I6	0.694	0.702	3.716E-37	258	0.590	0.597	Q6P3I6.pdb.gz	Q6P3I6_DANRE protein-serine/threonine phosphatase OS=Danio rerio OX=7955 GN=zgc:77714 PE=2 SV=1
4	AFDB:M9PFN0	0.747	0.557	5.440E-37	352	0.602	0.446	M9PFN0.pdb.gz	HZG_DROME Phosphatase Herzog OS=Drosophila melanogaster OX=7227 GN=hzg PE=1 SV=1
5	AFDB:O14595	0.694	0.669	2.344E-36	271	0.594	0.572	O14595.pdb.gz	CTDS2_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens OX=9606 GN=CTDSP2 PE=1 SV=2
6	AFDB:Q8T3G2	0.680	0.363	2.964E-31	491	0.579	0.308	Q8T3G2.pdb.gz	SCPL1_CAEEL CTD small phosphatase-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=scpl-1 PE=1 SV=2
7	AFDB:Q9XYL0	0.691	0.590	9.428E-28	306	0.490	0.418	Q9XYL0.pdb.gz	CTDS_DICDI Probable C-terminal domain small phosphatase OS=Dictyostelium discoideum OX=44689 GN=fcpA PE=3 SV=1
8	AFDB:Q5A7R0	0.679	0.404	8.168E-27	441	0.429	0.254	Q5A7R0.pdb.gz	Q5A7R0_CANAL Phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C300570CA PE=4 SV=1
9	AFDB:Q07949	0.671	0.444	2.562E-26	397	0.418	0.275	Q07949.pdb.gz	PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR2 PE=1 SV=1
10	AFDB:Q07800	0.657	0.405	4.257E-26	427	0.406	0.248	Q07800.pdb.gz	PSR1_YEAST Phosphatase PSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR1 PE=1 SV=1
11	PDB:2r8xH	0.295	0.382	7.368E-3	183	0.107	0.153	2r8xH.pdb.gz
12	PDB:1te2A	0.240	0.283	2.796E-2	218	0.069	0.083	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
13	PDB:2b0cA	0.348	0.442	2.796E-2	199	0.088	0.116	2b0cA.pdb.gz	The 2.0A crystal structure of the putative phosphatase from Escherichia coli
14	PDB:3l5kA	0.318	0.351	3.174E-2	233	0.065	0.073	3l5kA.pdb.gz
15	PDB:5it0A	0.330	0.230	4.093E-2	396	0.103	0.068	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
16	PDB:6a69A	0.219	0.074	4.361E-2	911	0.061	0.018	6a69A.pdb.gz
17	PDB:3j09A	0.258	0.105	6.383E-2	723	0.080	0.029	3j09A.pdb.gz
18	PDB:4bbjA	0.294	0.131	1.205E-1	664	0.096	0.038	4bbjA.pdb.gz	Copper-Transporting P-Type Atpases Use a Unique Ion-Release Pathway
19	PDB:5olwA	0.355	0.405	1.205E-1	224	0.107	0.125	5olwA.pdb.gz	Observing enzyme ternary transition state analogue complexes by19F NMR spectroscopy.
20	PDB:7ef7A	0.234	0.256	1.205E-1	236	0.065	0.072	7ef7A.pdb.gz	Initiation of cytosolic plant purine nucleotide catabolism involves a monospecific xanthosine monophosphate phosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58466	0.0	529	261	0.989	0.989	CTDS1_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Mus musculus OX=10090 GN=Ctdsp1 PE=1 SV=1
2	Q9GZU7	0.0	536	261	1.000	1.000	CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
3	H7C270	1.11e-177	490	254	0.939	0.965	H7C270_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
4	H7C1Z7	3.50e-176	487	262	0.916	0.912	H7C1Z7_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
5	P58465	3.73e-127	363	276	0.701	0.663	CTDSL_MOUSE CTD small phosphatase-like protein OS=Mus musculus OX=10090 GN=Ctdspl PE=2 SV=3
6	O15194	3.42e-120	346	276	0.690	0.652	CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens OX=9606 GN=CTDSPL PE=1 SV=2
7	Q6P3I6	1.32e-112	326	258	0.640	0.647	Q6P3I6_DANRE protein-serine/threonine phosphatase OS=Danio rerio OX=7955 GN=zgc:77714 PE=2 SV=1
8	O14595	5.42e-112	325	271	0.625	0.601	CTDS2_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens OX=9606 GN=CTDSP2 PE=1 SV=2
9	Q8BX07	2.95e-111	323	270	0.632	0.611	CTDS2_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Mus musculus OX=10090 GN=Ctdsp2 PE=2 SV=1
10	M9PFN0	5.65e-109	320	352	0.579	0.429	HZG_DROME Phosphatase Herzog OS=Drosophila melanogaster OX=7227 GN=hzg PE=1 SV=1
11	Q8T3G2	3.19e-89	274	491	0.548	0.291	SCPL1_CAEEL CTD small phosphatase-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=scpl-1 PE=1 SV=2
12	Q5A7R0	8.28e-70	223	441	0.387	0.229	Q5A7R0_CANAL Phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C300570CA PE=4 SV=1
13	H7C3E0	5.90e-68	210	195	0.402	0.538	H7C3E0_HUMAN CTD small phosphatase 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=8
14	Q9XYL0	1.13e-65	208	306	0.437	0.373	CTDS_DICDI Probable C-terminal domain small phosphatase OS=Dictyostelium discoideum OX=44689 GN=fcpA PE=3 SV=1
15	Q07949	2.60e-65	210	397	0.383	0.252	PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR2 PE=1 SV=1
16	Q07800	1.41e-63	206	427	0.352	0.215	PSR1_YEAST Phosphatase PSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR1 PE=1 SV=1
17	Q9LYI7	1.21e-52	175	305	0.383	0.328	Q9LYI7_ARATH At5g11860 OS=Arabidopsis thaliana OX=3702 GN=SSP5 PE=1 SV=1
18	Q8BG15	2.06e-44	157	465	0.287	0.161	CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus OX=10090 GN=Ctdspl2 PE=1 SV=1
19	Q57ZA0	2.38e-44	156	423	0.314	0.194	Q57ZA0_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1170 PE=4 SV=1
20	Q05D32	2.64e-44	157	466	0.287	0.161	CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03031 NIF	1.5e-48	176.0	NLI interacting factor-like phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273062

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311816	0.957	RE1-silencing transcription factor
2	9606.ENSP00000262160	0.933	Mothers against decapentaplegic homolog 2
3	9606.ENSP00000426568	0.931	Mothers against decapentaplegic homolog 1
4	9606.ENSP00000442068	0.924	Cell division cycle-associated protein 3
5	9606.ENSP00000332973	0.918	Mothers against decapentaplegic homolog 3
6	9606.ENSP00000273179	0.879	CTD small phosphatase-like protein
7	9606.ENSP00000380958	0.877	Myelin basic protein
8	9606.ENSP00000296786	0.803	Ubiquitin-like domain-containing CTD phosphatase 1
9	9606.ENSP00000484525	0.783	RNA polymerase II subunit A C-terminal domain phosphatase
10	9606.ENSP00000289388	0.730	Ciliogenesis-associated TTC17-interacting protein
11	9606.ENSP00000377969	0.717	General transcription factor IIF subunit 1
12	9606.ENSP00000381148	0.671	Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
13	9606.ENSP00000480158	0.621	DNA-directed RNA polymerase II subunit RPB1
14	9606.ENSP00000386665	0.581	Four and a half LIM domains protein 2
15	9606.ENSP00000349428	0.574	Polypyrimidine tract-binding protein 1
16	9606.ENSP00000233202	0.545	Natural resistance-associated macrophage protein 1
17	9606.ENSP00000264741	0.540	Integrin alpha-9
18	9606.ENSP00000291386	0.534	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
19	9606.ENSP00000297142	0.527	Neurogenic differentiation factor 6
20	9606.ENSP00000320180	0.515	Growth hormone-releasing hormone receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	0.998	phosphoprotein phosphatase activity
GO:0004722	0.798	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0080090	0.992	regulation of primary metabolic process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0009987	0.989	cellular process
GO:0008152	0.921	metabolic process
GO:0010468	0.859	regulation of gene expression
GO:0031326	0.850	regulation of cellular biosynthetic process
GO:0051252	0.839	regulation of RNA metabolic process
GO:0044237	0.826	cellular metabolic process
GO:0010556	0.826	regulation of macromolecule biosynthetic process
GO:0048519	0.809	negative regulation of biological process
GO:0006355	0.807	regulation of DNA-templated transcription
GO:0048523	0.798	negative regulation of cellular process
GO:0071704	0.778	organic substance metabolic process
GO:0044238	0.775	primary metabolic process
GO:0006807	0.700	nitrogen compound metabolic process
GO:0009892	0.655	negative regulation of metabolic process
GO:0043170	0.645	macromolecule metabolic process
GO:0031324	0.633	negative regulation of cellular metabolic process
GO:0051172	0.632	negative regulation of nitrogen compound metabolic process
GO:0051246	0.614	regulation of protein metabolic process
GO:0010605	0.603	negative regulation of macromolecule metabolic process
GO:1902806	0.578	regulation of cell cycle G1/S phase transition
GO:1901991	0.566	negative regulation of mitotic cell cycle phase transition
GO:0051174	0.516	regulation of phosphorus metabolic process
GO:0019220	0.495	regulation of phosphate metabolic process
GO:0016311	0.473	dephosphorylation
GO:2000134	0.449	negative regulation of G1/S transition of mitotic cell cycle
GO:0031399	0.438	regulation of protein modification process
GO:0042325	0.435	regulation of phosphorylation
GO:0045936	0.435	negative regulation of phosphate metabolic process
GO:0006357	0.424	regulation of transcription by RNA polymerase II
GO:1901564	0.411	organonitrogen compound metabolic process
GO:0042326	0.411	negative regulation of phosphorylation
GO:0031400	0.408	negative regulation of protein modification process
GO:0048518	0.385	positive regulation of biological process
GO:0001933	0.350	negative regulation of protein phosphorylation
GO:0006470	0.335	protein dephosphorylation
GO:0051239	0.309	regulation of multicellular organismal process
GO:0048522	0.308	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005576	0.494	extracellular region
GO:0031982	0.384	vesicle
GO:0005615	0.378	extracellular space
GO:0043230	0.375	extracellular organelle
GO:0070062	0.373	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:3.1.3.16	0.798	protein-serine/threonine phosphatase.

[back to server]