StarFunc result for job id Q9GZU8

User Input

>input (254 residues)
MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQE
QKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLK
KVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDK
NQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKI
VSSIFRTNTFLEAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZU8	1.000	1.000	1.323E-39	254	1.000	1.000	Q9GZU8.pdb.gz	PIP30_HUMAN PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1
2	AFDB:Q54LV6	0.115	0.109	1.926E-2	280	0.157	0.143	Q54LV6.pdb.gz	Y6946_DICDI Uncharacterized protein DDB_G0286393 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286393 PE=4 SV=1
3	AFDB:M9NEC7	0.173	0.067	4.666E-2	698	0.181	0.066	M9NEC7.pdb.gz	M9NEC7_DROME Hyperkinetic, isoform F OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
4	AFDB:F1RCU7	0.139	0.054	6.557E-2	1077	0.157	0.037	F1RCU7.pdb.gz
5	AFDB:P39730	0.135	0.048	9.216E-2	1002	0.193	0.049	P39730.pdb.gz	IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUN12 PE=1 SV=2
6	AFDB:Q389J7	0.121	0.103	1.210E-1	306	0.157	0.131	Q389J7.pdb.gz	Q389J7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0520 PE=4 SV=1
7	AFDB:Q9FUY2	0.152	0.047	1.295E-1	931	0.110	0.030	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
8	AFDB:Q9LV52	0.153	0.147	1.701E-1	330	0.165	0.127	Q9LV52.pdb.gz	HSFC1_ARATH Heat stress transcription factor C-1 OS=Arabidopsis thaliana OX=3702 GN=HSFC1 PE=1 SV=1
9	AFDB:Q5SWU0	0.110	0.073	1.949E-1	428	0.126	0.075	Q5SWU0.pdb.gz	Q5SWU0_MOUSE IKAROS family zinc finger 1 OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=1
10	AFDB:Q5ZIP0	0.118	0.068	1.949E-1	501	0.185	0.094	Q5ZIP0.pdb.gz	Q5ZIP0_CHICK RING-type E3 ubiquitin transferase OS=Gallus gallus OX=9031 GN=RCJMB04_24j13 PE=2 SV=1
11	PDB:7r5jV0	0.109	0.102	1.097	273	0.102	0.095	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7egmI	0.111	0.234	2.319	106	0.039	0.094	7egmI.pdb.gz
13	PDB:7puaFO	0.088	0.069	5.250	328	0.047	0.037	7puaFO.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
14	PDB:4n78F	0.163	0.232	6.015	156	0.055	0.090	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
15	PDB:6lthQ	0.100	0.217	6.015	105	0.106	0.257	6lthQ.pdb.gz	Structure of nucleosome-bound human BAF complex.
16	PDB:7mq8LU	0.097	0.060	7.898	445	0.059	0.034	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7a5fA	0.162	0.251	8.455	162	0.063	0.099	7a5fA.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
18	PDB:4v60A	0.143	0.061	9.688	812	0.091	0.028	4v60A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZU8	0.0	513	254	1.000	1.000	PIP30_HUMAN PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1
2	Q04602	0.39	34.7	768	0.114	0.038	VBA4_YEAST Vacuolar basic amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VBA4 PE=1 SV=1
3	O81283	1.5	32.7	1503	0.083	0.014	TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1
4	Q6FRZ8	2.6	32.0	588	0.126	0.054	AP1_CANGA bZip transcription factor GAP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05163 DinB	9.5e+02	11.1	DinB family
2	PF10187 FAM192A_Fyv6_N	1.2e-27	107.7	FAM192A/Fyv6, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335808

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293362	0.905	Proteasome activator complex subunit 3
2	9606.ENSP00000412886	0.879	Calmodulin-binding transcription activator 2
3	9606.ENSP00000361716	0.844	Ras-related protein Rab-40A
4	9606.ENSP00000443176	0.822	Ring finger and SPRY domain containing 1
5	9606.ENSP00000380054	0.797	ELL-associated factor 1
6	9606.ENSP00000262103	0.781	EF-hand calcium-binding domain-containing protein 1
7	9606.ENSP00000407613	0.780	S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Ser)
8	9606.ENSP00000324204	0.768	Maturin
9	9606.ENSP00000332062	0.761	Sorting nexin-20
10	9606.ENSP00000219204	0.756	ADP-ribosylation factor-like protein 2-binding protein
11	9606.ENSP00000218249	0.744	Ras-related protein Rab-40A-like
12	9606.ENSP00000222803	0.729	Peptidyl-prolyl cis-trans isomerase FKBP14
13	9606.ENSP00000301825	0.724	Ectonucleoside triphosphate diphosphohydrolase 3
14	9606.ENSP00000397947	0.724	Pleckstrin homology domain-containing family A member 8
15	9606.ENSP00000414359	0.723	Proteasome subunit alpha type-1
16	9606.ENSP00000275428	0.721	Gamma-glutamylcyclotransferase
17	9606.ENSP00000323879	0.680	E3 ubiquitin-protein ligase ZNRF2
18	9606.ENSP00000373918	0.669	Glycine--tRNA ligase
19	9606.ENSP00000369390	0.652	Cyclin-dependent kinase 14
20	9606.ENSP00000338533	0.637	Tetratricopeptide repeat domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.983	regulation of biological process
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0080090	0.903	regulation of primary metabolic process
GO:0051171	0.902	regulation of nitrogen compound metabolic process
GO:0051246	0.861	regulation of protein metabolic process
GO:0048519	0.845	negative regulation of biological process
GO:0042176	0.797	regulation of protein catabolic process
GO:0050794	0.775	regulation of cellular process
GO:0010605	0.756	negative regulation of macromolecule metabolic process
GO:0065009	0.750	regulation of molecular function
GO:0030162	0.735	regulation of proteolysis
GO:0044092	0.728	negative regulation of molecular function
GO:0009987	0.696	cellular process
GO:0045861	0.686	negative regulation of proteolysis
GO:0042177	0.686	negative regulation of protein catabolic process
GO:1903050	0.645	regulation of proteolysis involved in protein catabolic process
GO:0061136	0.633	regulation of proteasomal protein catabolic process
GO:1903051	0.582	negative regulation of proteolysis involved in protein catabolic process
GO:0051098	0.580	regulation of binding
GO:0043393	0.567	regulation of protein binding
GO:0051100	0.567	negative regulation of binding
GO:1901799	0.567	negative regulation of proteasomal protein catabolic process
GO:0032091	0.530	negative regulation of protein binding
GO:0031323	0.341	regulation of cellular metabolic process
GO:0008152	0.328	metabolic process
GO:0071704	0.313	organic substance metabolic process
GO:0044238	0.301	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.948	intracellular organelle lumen
GO:0005737	0.941	cytoplasm
GO:0031981	0.809	nuclear lumen
GO:0005654	0.795	nucleoplasm
GO:0032991	0.695	protein-containing complex
GO:0043232	0.463	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]