StarFunc result for job id Q9GZV1

User Input

>input (360 residues)
MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRG
DARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRK
KRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQF
RRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADT
NVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLL
LHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZV1	1.000	1.000	1.793E-50	360	1.000	1.000	Q9GZV1.pdb.gz	ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=3
2	AFDB:Q9WV06	0.565	0.617	4.093E-39	328	0.814	0.893	Q9WV06.pdb.gz	ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ankrd2 PE=1 SV=3
3	AFDB:Q5T457	0.383	0.445	8.830E-35	300	0.833	1.000	Q5T457.pdb.gz	Q5T457_HUMAN Ankyrin repeat domain 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=1
4	AFDB:F1NYV8	0.523	0.589	1.294E-21	319	0.386	0.436	F1NYV8.pdb.gz	F1NYV8_CHICK Ankyrin repeat domain 1 OS=Gallus gallus OX=9031 GN=ANKRD1 PE=4 SV=1
5	AFDB:A0A384NYH5	0.525	0.592	3.839E-21	319	0.392	0.442	A0A384NYH5.pdb.gz	A0A384NYH5_HUMAN Ankyrin repeat domain 1 (Cardiac muscle) OS=Homo sapiens OX=9606 GN=ANKRD1 PE=2 SV=1
6	AFDB:Q86SG2	0.511	0.601	1.744E-20	305	0.336	0.397	Q86SG2.pdb.gz	ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ANKRD23 PE=1 SV=1
7	AFDB:Q812A3	0.523	0.613	3.076E-20	306	0.344	0.405	Q812A3.pdb.gz	ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus OX=10090 GN=Ankrd23 PE=2 SV=1
8	AFDB:Q8GZ22	0.401	0.581	2.608E-12	240	0.178	0.267	Q8GZ22.pdb.gz	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
9	AFDB:A0A0G2K7U7	0.411	0.144	6.405E-12	1054	0.211	0.072	A0A0G2K7U7.pdb.gz	A0A0G2K7U7_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
10	AFDB:A2ABF8	0.390	0.127	7.041E-12	1233	0.222	0.065	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
11	PDB:2dvwA	0.459	0.710	4.606E-11	229	0.169	0.266	2dvwA.pdb.gz
12	PDB:8cs9A	0.465	0.214	7.050E-11	796	0.156	0.070	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:6v9hC	0.384	0.498	2.025E-9	270	0.164	0.219	6v9hC.pdb.gz
14	PDB:6mwqA	0.404	0.297	2.957E-9	493	0.153	0.112	6mwqA.pdb.gz
15	PDB:6jd6B	0.412	0.751	1.165E-8	192	0.139	0.260	6jd6B.pdb.gz
16	PDB:4oauC	0.465	0.247	1.343E-8	692	0.142	0.074	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
17	PDB:1wg0A	0.450	0.654	2.369E-8	243	0.139	0.206	1wg0A.pdb.gz
18	PDB:6pqpA	0.425	0.255	6.706E-8	615	0.128	0.075	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:5vkqA	0.243	0.085	9.789E-8	1499	0.158	0.038	5vkqA.pdb.gz
20	PDB:1bd8A	0.386	0.844	1.810E-7	156	0.125	0.288	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRN9	0.0	676	333	0.925	1.000	A0A0A0MRN9_HUMAN Ankyrin repeat domain 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=1
2	Q5T457	0.0	539	300	0.819	0.983	Q5T457_HUMAN Ankyrin repeat domain 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=1
3	Q9GZV1	0.0	731	360	1.000	1.000	ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKRD2 PE=1 SV=3
4	Q9WV06	0.0	545	328	0.814	0.893	ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ankrd2 PE=1 SV=3
5	Q8R560	4.29e-82	254	319	0.333	0.376	ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ankrd1 PE=1 SV=1
6	Q9CR42	3.66e-81	252	319	0.328	0.370	ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankrd1 PE=1 SV=1
7	A0A384NYH5	6.57e-81	251	319	0.325	0.367	A0A384NYH5_HUMAN Ankyrin repeat domain 1 (Cardiac muscle) OS=Homo sapiens OX=9606 GN=ANKRD1 PE=2 SV=1
8	Q15327	6.57e-81	251	319	0.325	0.367	ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKRD1 PE=1 SV=2
9	F1NYV8	1.12e-79	248	319	0.308	0.348	F1NYV8_CHICK Ankyrin repeat domain 1 OS=Gallus gallus OX=9031 GN=ANKRD1 PE=4 SV=1
10	Q865U8	1.92e-79	248	319	0.322	0.364	ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa OX=9823 GN=ANKRD1 PE=2 SV=1
11	Q7ZT11	6.18e-79	246	319	0.306	0.345	ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus OX=9031 GN=ANKRD1 PE=2 SV=1
12	Q86SG2	1.69e-61	201	305	0.303	0.357	ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ANKRD23 PE=1 SV=1
13	Q812A3	1.30e-60	199	306	0.272	0.320	ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus OX=10090 GN=Ankrd23 PE=2 SV=1
14	D3ZVB9	2.75e-59	195	298	0.272	0.329	D3ZVB9_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=3
15	A0A8I6B0D0	3.50e-59	195	306	0.272	0.320	A0A8I6B0D0_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=1
16	A0A8I6GH25	3.27e-35	131	273	0.217	0.286	A0A8I6GH25_RAT Ankyrin repeat domain 23 OS=Rattus norvegicus OX=10116 GN=Ankrd23 PE=4 SV=1
17	Q8N8A2	2.45e-28	118	993	0.181	0.065	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
18	O15084	5.34e-26	111	1053	0.172	0.059	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
19	A0A1B0GU48	6.65e-24	105	981	0.175	0.064	A0A1B0GU48_HUMAN Euchromatic histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
20	A0A1B0GV09	1.02e-23	105	1267	0.175	0.050	A0A1B0GV09_HUMAN Euchromatic histone lysine methyltransferase 1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.9e-23	93.0	Ankyrin repeat
2	PF12796 Ank_2	6e-28	108.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.4e-18	74.3	Ankyrin repeat
4	PF13637 Ank_4	7.8e-24	95.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3e-18	76.9	Ankyrin repeats (many copies)
6	PF06128 Shigella_OspC	6.4e+02	11.5	Shigella flexneri OspC protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306163

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467141	0.967	Titin
2	9606.ENSP00000312624	0.888	Telethonin
3	9606.ENSP00000269305	0.784	Cellular tumor antigen p53
4	9606.ENSP00000431813	0.724	Cysteine and glycine-rich protein 3
5	9606.ENSP00000361626	0.700	Nuclease-sensitive element-binding protein 1
6	9606.ENSP00000435466	0.670	Kin of IRRE-like protein 3
7	9606.ENSP00000377036	0.647	Serine/threonine-protein phosphatase 2A activator
8	9606.ENSP00000365145	0.637	Forkhead box protein S1
9	9606.ENSP00000351790	0.627	Myopalladin
10	9606.ENSP00000378165	0.618	BUB3-interacting and GLEBS motif-containing protein ZNF207
11	9606.ENSP00000401437	0.593	LIM domain-binding protein 3
12	9606.ENSP00000264995	0.587	Mitochondrial ribosomal protein L3
13	9606.ENSP00000464317	0.584	Myosin-3
14	9606.ENSP00000455625	0.578	cAMP-regulated phosphoprotein 19
15	9606.ENSP00000263579	0.577	m7GpppX diphosphatase
16	9606.ENSP00000347507	0.574	Myosin-7
17	9606.ENSP00000380349	0.574	Calpain-3
18	9606.ENSP00000402373	0.542	Actin, aortic smooth muscle
19	9606.ENSP00000480401	0.536	Zinc finger protein 205
20	9606.ENSP00000228841	0.516	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:0008134	0.997	transcription factor binding
GO:0043422	0.993	protein kinase B binding
GO:0061629	0.877	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0008092	0.421	cytoskeletal protein binding
GO:0003824	0.404	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.977	response to stimulus
GO:0045661	0.967	regulation of myoblast differentiation
GO:0048523	0.965	negative regulation of cellular process
GO:0080090	0.821	regulation of primary metabolic process
GO:0031326	0.789	regulation of cellular biosynthetic process
GO:0019219	0.785	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.769	regulation of RNA metabolic process
GO:0006355	0.762	regulation of DNA-templated transcription
GO:0051716	0.712	cellular response to stimulus
GO:0031324	0.656	negative regulation of cellular metabolic process
GO:0042221	0.611	response to chemical
GO:0010605	0.590	negative regulation of macromolecule metabolic process
GO:0006357	0.575	regulation of transcription by RNA polymerase II
GO:0051172	0.574	negative regulation of nitrogen compound metabolic process
GO:0006950	0.553	response to stress
GO:0070887	0.531	cellular response to chemical stimulus
GO:0009890	0.497	negative regulation of biosynthetic process
GO:0032502	0.484	developmental process
GO:0048856	0.467	anatomical structure development
GO:0043620	0.420	regulation of DNA-templated transcription in response to stress
GO:0010558	0.398	negative regulation of macromolecule biosynthetic process
GO:0045934	0.392	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.388	negative regulation of cellular biosynthetic process
GO:0048518	0.383	positive regulation of biological process
GO:1902679	0.367	negative regulation of RNA biosynthetic process
GO:0048522	0.356	positive regulation of cellular process
GO:0032501	0.348	multicellular organismal process
GO:0051093	0.336	negative regulation of developmental process
GO:0061061	0.318	muscle structure development
GO:0045892	0.318	negative regulation of DNA-templated transcription
GO:0048513	0.314	animal organ development
GO:0045596	0.300	negative regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0005634	0.943	nucleus
GO:0043232	0.391	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]