StarFunc result for job id Q9GZV3

User Input

>input (580 residues)
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BGY9	0.928	0.928	2.675E-68	580	0.929	0.929	Q8BGY9.pdb.gz	SC5A7_MOUSE High affinity choline transporter 1 OS=Mus musculus OX=10090 GN=Slc5a7 PE=1 SV=1
2	AFDB:Q8UWF0	0.916	0.910	1.865E-59	584	0.722	0.717	Q8UWF0.pdb.gz	SC5A7_TORMA High-affinity choline transporter 1 OS=Torpedo marmorata OX=7788 GN=CHT1 PE=2 SV=1
3	AFDB:O02228	0.828	0.833	4.946E-42	576	0.493	0.497	O02228.pdb.gz	SC5A7_CAEEL High-affinity choline transporter 1 OS=Caenorhabditis elegans OX=6239 GN=cho-1 PE=2 SV=2
4	AFDB:P32705	0.727	0.765	4.073E-18	549	0.169	0.179	P32705.pdb.gz	ACTP_ECOLI Cation/acetate symporter ActP OS=Escherichia coli (strain K12) OX=83333 GN=actP PE=1 SV=1
5	AFDB:Q79VH1	0.714	0.783	1.118E-17	524	0.181	0.200	Q79VH1.pdb.gz	Q79VH1_CORGL Sodium/proline symporter OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl1163 PE=3 SV=1
6	AFDB:Q9I5F5	0.711	0.808	2.613E-16	506	0.184	0.211	Q9I5F5.pdb.gz	Q9I5F5_PSEAE Sodium/proline symporter OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=putP PE=3 SV=1
7	AFDB:P94392	0.701	0.847	3.072E-16	473	0.198	0.243	P94392.pdb.gz	PUTP_BACSU High-affinity proline transporter PutP OS=Bacillus subtilis (strain 168) OX=224308 GN=putP PE=1 SV=3
8	AFDB:P07117	0.697	0.798	5.631E-16	502	0.176	0.203	P07117.pdb.gz	PUTP_ECOLI Sodium/proline symporter OS=Escherichia coli (strain K12) OX=83333 GN=putP PE=1 SV=1
9	AFDB:Q8K0E3	0.725	0.632	1.213E-15	673	0.198	0.171	Q8K0E3.pdb.gz	SC5AB_MOUSE Sodium/myo-inositol cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a11 PE=1 SV=1
10	AFDB:Q8WWX8	0.712	0.619	1.315E-15	675	0.193	0.166	Q8WWX8.pdb.gz	SC5AB_HUMAN Sodium/myo-inositol cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A11 PE=1 SV=1
11	PDB:7wmvA	0.680	0.657	5.892E-14	602	0.205	0.198	7wmvA.pdb.gz	Structural mechanism of SGLT1 inhibitors.
12	PDB:7vsiA	0.691	0.684	7.211E-14	586	0.202	0.200	7vsiA.pdb.gz	Structural basis of inhibition of the human SGLT2-MAP17 glucose transporter.
13	PDB:7sl9A	0.658	0.757	2.149E-10	497	0.136	0.159	7sl9A.pdb.gz	Structure and mechanism of the SGLT family of glucose transporters.
14	PDB:7slaA	0.617	0.612	6.660E-10	585	0.191	0.190	7slaA.pdb.gz	Structure and mechanism of the SGLT family of glucose transporters.
15	PDB:7s1xB	0.438	0.313	5.449E-6	871	0.122	0.082	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
16	PDB:7dskB	0.442	0.533	1.907E-4	464	0.121	0.151	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
17	PDB:4djiA	0.367	0.414	3.225E-4	493	0.133	0.156	4djiA.pdb.gz
18	PDB:7d10A	0.434	0.541	4.830E-4	446	0.109	0.141	7d10A.pdb.gz
19	PDB:7cmhB	0.409	0.497	1.223E-3	458	0.095	0.120	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
20	PDB:3lrbA	0.423	0.563	3.497E-3	410	0.103	0.146	3lrbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O02228	0.0	553	576	0.507	0.510	SC5A7_CAEEL High-affinity choline transporter 1 OS=Caenorhabditis elegans OX=6239 GN=cho-1 PE=2 SV=2
2	Q8BGY9	0.0	1104	580	0.929	0.929	SC5A7_MOUSE High affinity choline transporter 1 OS=Mus musculus OX=10090 GN=Slc5a7 PE=1 SV=1
3	Q8UWF0	0.0	863	584	0.722	0.717	SC5A7_TORMA High-affinity choline transporter 1 OS=Torpedo marmorata OX=7788 GN=CHT1 PE=2 SV=1
4	Q9GZV3	0.0	1172	580	1.000	1.000	SC5A7_HUMAN High affinity choline transporter 1 OS=Homo sapiens OX=9606 GN=SLC5A7 PE=1 SV=1
5	Q9JMD7	0.0	1109	580	0.931	0.931	SC5A7_RAT High affinity choline transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a7 PE=1 SV=1
6	P11170	4.78e-14	77.4	662	0.214	0.187	SC5A1_RABIT Sodium/glucose cotransporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC5A1 PE=1 SV=1
7	P53792	5.77e-13	73.9	670	0.184	0.160	SC5A2_RAT Sodium/glucose cotransporter 2 OS=Rattus norvegicus OX=10116 GN=Slc5a2 PE=1 SV=1
8	Q9NY91	2.27e-12	72.0	659	0.171	0.150	SC5A4_HUMAN Probable glucose sensor protein SLC5A4 OS=Homo sapiens OX=9606 GN=SLC5A4 PE=1 SV=1
9	Q923I7	4.65e-12	71.2	670	0.184	0.160	SC5A2_MOUSE Sodium/glucose cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a2 PE=1 SV=1
10	D3ZIS0	1.50e-11	69.7	671	0.191	0.165	SC5A4_RAT Solute carrier family 5 member 4 OS=Rattus norvegicus OX=10116 GN=Slc5a4 PE=3 SV=1
11	Q8C3K6	1.54e-11	69.7	665	0.212	0.185	SC5A1_MOUSE Sodium/glucose cotransporter 1 OS=Mus musculus OX=10090 GN=Slc5a1 PE=1 SV=1
12	P94392	2.46e-11	68.6	473	0.183	0.224	PUTP_BACSU High-affinity proline transporter PutP OS=Bacillus subtilis (strain 168) OX=224308 GN=putP PE=1 SV=3
13	P31639	2.66e-11	68.9	672	0.181	0.156	SC5A2_HUMAN Sodium/glucose cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A2 PE=1 SV=1
14	Q8K0E3	2.69e-11	68.9	673	0.172	0.149	SC5AB_MOUSE Sodium/myo-inositol cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a11 PE=1 SV=1
15	A0PJT9	1.23e-10	66.6	659	0.178	0.156	A0PJT9_MOUSE Slc5a4b protein OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
16	P53790	1.46e-10	66.6	665	0.216	0.188	SC5A1_RAT Sodium/glucose cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a1 PE=2 SV=1
17	Q91ZP4	1.46e-10	66.2	660	0.178	0.156	S5A4B_MOUSE Solute carrier family 5 member 4B OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=2
18	Q2VPB3	1.54e-10	66.2	657	0.178	0.157	Q2VPB3_MOUSE Slc5a4b protein (Fragment) OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
19	Q3UNC8	1.63e-10	66.2	660	0.178	0.156	Q3UNC8_MOUSE Solute carrier family 5 member 4 OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
20	Q9Z1F2	1.89e-10	66.2	673	0.164	0.141	SC5AB_RAT Sodium/myo-inositol cotransporter 2 OS=Rattus norvegicus OX=10116 GN=Slc5a11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00474 SSF	2.5e-31	120.6	Sodium:solute symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264047

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363229	0.940	Vesicular acetylcholine transporter
2	9606.ENSP00000485520	0.907	HCG1732469
3	9606.ENSP00000243662	0.817	Ras-related protein Rab-38
4	9606.ENSP00000337103	0.785	Choline O-acetyltransferase
5	9606.ENSP00000356198	0.747	Chitotriosidase-1
6	9606.ENSP00000386942	0.738	Beta-galactoside alpha-2,6-sialyltransferase 2
7	9606.ENSP00000363852	0.728	Choline transporter-like protein 1
8	9606.ENSP00000367096	0.697	Protocadherin-9
9	9606.ENSP00000321498	0.687	Sugar phosphate exchanger 3
10	9606.ENSP00000336888	0.677	Choline transporter-like protein 2
11	9606.ENSP00000382163	0.673	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
12	9606.ENSP00000458537	0.658	Chymotrypsin-like protease CTRL-1
13	9606.ENSP00000365694	0.652	Serine/threonine-protein phosphatase 1 regulatory subunit 10
14	9606.ENSP00000260363	0.650	Kinesin-like protein KIF23
15	9606.ENSP00000300305	0.642	Runt-related transcription factor 1
16	9606.ENSP00000308318	0.641	Protein phosphatase 1 regulatory subunit 3B
17	9606.ENSP00000360035	0.641	Protein phosphatase 1 regulatory subunit 3D
18	9606.ENSP00000271227	0.636	Choline transporter-like protein 3
19	9606.ENSP00000283195	0.630	E3 SUMO-protein ligase RanBP2
20	9606.ENSP00000303211	0.630	Acetylcholinesterase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015220	1.000	choline transmembrane transporter activity
GO:0005515	0.979	protein binding
GO:0015075	0.903	monoatomic ion transmembrane transporter activity
GO:0008324	0.860	monoatomic cation transmembrane transporter activity
GO:0022804	0.808	active transmembrane transporter activity
GO:0015318	0.792	inorganic molecular entity transmembrane transporter activity
GO:0015291	0.755	secondary active transmembrane transporter activity
GO:0022853	0.501	active monoatomic ion transmembrane transporter activity
GO:0022890	0.490	inorganic cation transmembrane transporter activity
GO:0015293	0.479	symporter activity
GO:0015294	0.464	solute:monoatomic cation symporter activity
GO:0046873	0.439	metal ion transmembrane transporter activity
GO:0015370	0.416	solute:sodium symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.988	biological regulation
GO:0042133	0.978	neurotransmitter metabolic process
GO:0009058	0.975	biosynthetic process
GO:0071704	0.955	organic substance metabolic process
GO:1901564	0.907	organonitrogen compound metabolic process
GO:0044249	0.852	cellular biosynthetic process
GO:0051179	0.836	localization
GO:1901566	0.815	organonitrogen compound biosynthetic process
GO:0051234	0.808	establishment of localization
GO:0006810	0.795	transport
GO:0055085	0.310	transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.976	organelle
GO:0005622	0.970	intracellular anatomical structure
GO:0043227	0.969	membrane-bounded organelle
GO:0043229	0.956	intracellular organelle
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005737	0.915	cytoplasm
GO:0012505	0.883	endomembrane system
GO:0031982	0.818	vesicle
GO:0030054	0.745	cell junction
GO:0045202	0.712	synapse
GO:0036477	0.344	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.416	Na(+)(in) = Na(+)(out)

[back to server]