StarFunc result for job id Q9GZV8

User Input

>input (571 residues)
MALPRPSEAVPQDKVCYPPESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAA
SAAPAMPPFPFRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSHE
YAGASSEDLGHQIIGGDNESGPCCGPDTLIPPPPADASLLPEGLRTSQLLPCSPSKQSED
GPKPSNQEGKSPARFQFTEEDLHFVLYGVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQ
TLDKDSLQLPEGLCLMQTVFGEVPHFGVFCSSFIAKGVRFGPFQGKVVNASEVKTYGDNS
VMWEIFEDGHLSHFIDGKGGTGNWMSYVNCARFPKEQNLVAVQCQGHIFYESCKEIHQNQ
ELLVWYGDCYEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYKYYRDKHLK
YTPCVDKGDRKFPCSLCKRSFEKRDRLRIHILHVHEKHRPHKCSTCGKCFSQSSSLNKHM
RVHSGDRPYQCVYCTKRFTASSILRTHIRQHSGEKPFKCKYCGKSFASHAAHDSHVRRSH
KEDDGCSCSICGKIFSDQETFYSHMKFHEDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZV8	1.000	1.000	0.000	571	1.000	1.000	Q9GZV8.pdb.gz	PRD14_HUMAN PR domain zinc finger protein 14 OS=Homo sapiens OX=9606 GN=PRDM14 PE=1 SV=1
2	AFDB:P57071	0.189	0.076	3.058E-16	1507	0.268	0.102	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
3	AFDB:P41183	0.210	0.173	1.187E-15	707	0.210	0.170	P41183.pdb.gz	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
4	AFDB:E9Q8G5	0.160	0.135	2.994E-15	680	0.189	0.159	E9Q8G5.pdb.gz	ZFOI1_MOUSE Zinc finger protein OBI1 OS=Mus musculus OX=10090 GN=ObI1 PE=1 SV=1
5	AFDB:A0A096MJU6	0.205	0.140	3.527E-14	857	0.240	0.160	A0A096MJU6.pdb.gz	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
6	AFDB:Q9VI93	0.197	0.123	1.549E-13	946	0.215	0.130	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
7	AFDB:Q923B3	0.201	0.144	1.648E-13	828	0.175	0.121	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
8	AFDB:Q8NAP3	0.217	0.113	6.016E-13	1195	0.205	0.098	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
9	AFDB:Q4WT96	0.186	0.186	2.336E-12	570	0.217	0.218	Q4WT96.pdb.gz	Q4WT96_ASPFU C2H2 transcription factor, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G10080 PE=4 SV=1
10	AFDB:E9PEP7	0.149	0.120	2.989E-12	755	0.212	0.160	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
11	PDB:5h6zA	0.161	0.647	3.719E-4	123	0.042	0.195	5h6zA.pdb.gz
12	PDB:5hynA	0.166	0.164	1.277E-3	581	0.037	0.036	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
13	PDB:5wg6A	0.161	0.177	1.536E-3	517	0.039	0.043	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
14	PDB:2g46A	0.147	0.562	2.224E-3	119	0.035	0.168	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
15	PDB:7ksoA	0.159	0.224	2.676E-3	395	0.040	0.058	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
16	PDB:7td5A	0.160	0.182	2.676E-3	497	0.040	0.046	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:1pegA	0.162	0.324	4.660E-3	266	0.035	0.075	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:7td5F	0.162	0.204	5.607E-3	447	0.040	0.051	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
19	PDB:3qxyA	0.094	0.125	3.152E-2	420	0.014	0.019	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
20	PDB:6wkrC	0.161	0.152	3.353E-2	606	0.033	0.031	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q3T6	0.0	764	561	0.697	0.709	PRD14_MOUSE PR domain zinc finger protein 14 OS=Mus musculus OX=10090 GN=Prdm14 PE=1 SV=1
2	F1QWQ9	0.0	527	568	0.440	0.442	F1QWQ9_DANRE PR domain zinc finger protein 14 isoform X1 OS=Danio rerio OX=7955 GN=fc16b12 PE=4 SV=1
3	Q9GZV8	0.0	1179	571	1.000	1.000	PRD14_HUMAN PR domain zinc finger protein 14 OS=Homo sapiens OX=9606 GN=PRDM14 PE=1 SV=1
4	Q6XSK8	3.15e-157	461	517	0.366	0.404	Q6XSK8_DANRE PR domain zinc finger protein 14 OS=Danio rerio OX=7955 GN=wu:fc16b12 PE=4 SV=2
5	C9JMM8	1.10e-62	202	99	0.173	1.000	C9JMM8_HUMAN PR/SET domain 14 (Fragment) OS=Homo sapiens OX=9606 GN=PRDM14 PE=1 SV=8
6	Q5U3V3	2.47e-45	166	366	0.184	0.287	Q5U3V3_DANRE PR domain zinc finger protein 12 OS=Danio rerio OX=7955 GN=prdm12b PE=2 SV=1
7	Q7T0V8	1.43e-43	160	355	0.196	0.315	Q7T0V8_XENLA PR domain zinc finger protein 12 OS=Xenopus laevis OX=8355 GN=prdm12.L PE=2 SV=1
8	Q3UZD5	6.20e-43	164	596	0.215	0.206	PRDM6_MOUSE Putative histone-lysine N-methyltransferase PRDM6 OS=Mus musculus OX=10090 GN=Prdm6 PE=1 SV=1
9	Q9NQX0	8.13e-43	164	595	0.212	0.203	PRDM6_HUMAN Putative histone-lysine N-methyltransferase PRDM6 OS=Homo sapiens OX=9606 GN=PRDM6 PE=1 SV=2
10	A2AJ77	5.21e-42	157	365	0.182	0.285	PRD12_MOUSE PR domain zinc finger protein 12 OS=Mus musculus OX=10090 GN=Prdm12 PE=2 SV=1
11	Q9H4Q4	8.50e-42	156	367	0.182	0.283	PRD12_HUMAN PR domain zinc finger protein 12 OS=Homo sapiens OX=9606 GN=PRDM12 PE=1 SV=2
12	Q9UKN5	6.31e-39	154	801	0.175	0.125	PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens OX=9606 GN=PRDM4 PE=1 SV=3
13	Q80V63	1.28e-38	153	803	0.179	0.127	PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus OX=10090 GN=Prdm4 PE=2 SV=2
14	Q9QZP2	1.52e-38	153	798	0.177	0.127	PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus OX=10116 GN=Prdm4 PE=2 SV=1
15	Q9BUY5	5.75e-32	132	554	0.119	0.123	ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens OX=9606 GN=ZNF426 PE=1 SV=1
16	P17029	1.85e-30	127	563	0.124	0.126	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
17	Q96MU6	3.77e-30	127	729	0.119	0.093	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
18	Q15937	3.98e-30	125	498	0.117	0.135	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
19	Q3KQV3	5.27e-30	127	632	0.124	0.112	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
20	Q16600	8.98e-30	124	458	0.123	0.153	ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00856 SET	0.35	22.7	SET domain
2	PF00096 zf-C2H2	1.1e-16	71.3	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	1.6	19.9	zinc-finger C2H2-type
4	PF12756 zf-C2H2_2	41	15.9	C2H2 type zinc-finger (2 copies)
5	PF13894 zf-C2H2_4	1.4e-13	61.4	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.14	23.4	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	0.015	26.8	Zinc-finger double-stranded RNA-binding
8	PF13913 zf-C2HC_2	59	15.0	zinc-finger of a C2HC-type
9	PF05605 zf-Di19	44	15.8	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	5.6e-14	63.0	Zinc-finger double domain
11	PF12874 zf-met	3.1e+02	13.2	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276594

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262653	0.991	Protein CBFA2T2
2	9606.ENSP00000229307	0.965	Homeobox protein NANOG
3	9606.ENSP00000259915	0.949	POU domain, class 5, transcription factor 1
4	9606.ENSP00000323588	0.948	Transcription factor SOX-2
5	9606.ENSP00000217086	0.874	Sal-like protein 4
6	9606.ENSP00000363314	0.858	Protein lin-28 homolog A
7	9606.ENSP00000252463	0.851	Zinc finger and SCAN domain-containing protein 10
8	9606.ENSP00000320147	0.844	Histone-lysine N-methyltransferase EZH2
9	9606.ENSP00000484803	0.840	Forkhead box protein P1
10	9606.ENSP00000341992	0.822	Nanos homolog 3
11	9606.ENSP00000250863	0.809	Deleted in azoospermia-like
12	9606.ENSP00000316578	0.797	Polycomb protein SUZ12
13	9606.ENSP00000201031	0.796	Transcription factor AP-2 gamma
14	9606.ENSP00000363804	0.747	Krueppel-like factor 4
15	9606.ENSP00000362748	0.743	Methylcytosine dioxygenase TET1
16	9606.ENSP00000262160	0.737	Mothers against decapentaplegic homolog 2
17	9606.ENSP00000422488	0.711	Steroid hormone receptor ERR2
18	9606.ENSP00000405890	0.696	Pre-B-cell leukemia transcription factor 1
19	9606.ENSP00000384725	0.692	Putative histone-lysine N-methyltransferase PRDM6
20	9606.ENSP00000325690	0.685	Histone-arginine methyltransferase CARM1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140110	0.831	transcription regulator activity
GO:0003676	0.791	nucleic acid binding
GO:0003677	0.779	DNA binding
GO:0043565	0.733	sequence-specific DNA binding
GO:1990837	0.636	sequence-specific double-stranded DNA binding
GO:0000976	0.543	transcription cis-regulatory region binding
GO:0003700	0.470	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0032502	0.977	developmental process
GO:0048523	0.976	negative regulation of cellular process
GO:0031327	0.974	negative regulation of cellular biosynthetic process
GO:0009987	0.969	cellular process
GO:0032501	0.962	multicellular organismal process
GO:0048856	0.958	anatomical structure development
GO:0010468	0.935	regulation of gene expression
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0010605	0.916	negative regulation of macromolecule metabolic process
GO:0045934	0.899	negative regulation of nucleobase-containing compound metabolic process
GO:0048518	0.864	positive regulation of biological process
GO:0048522	0.854	positive regulation of cellular process
GO:0019827	0.815	stem cell population maintenance
GO:0010558	0.805	negative regulation of macromolecule biosynthetic process
GO:1903507	0.755	negative regulation of nucleic acid-templated transcription
GO:0045892	0.744	negative regulation of DNA-templated transcription
GO:0009893	0.707	positive regulation of metabolic process
GO:0048869	0.702	cellular developmental process
GO:0010604	0.673	positive regulation of macromolecule metabolic process
GO:0031325	0.661	positive regulation of cellular metabolic process
GO:0051173	0.659	positive regulation of nitrogen compound metabolic process
GO:0007275	0.583	multicellular organism development
GO:0050896	0.517	response to stimulus
GO:0006357	0.512	regulation of transcription by RNA polymerase II
GO:0030154	0.464	cell differentiation
GO:0045935	0.431	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.422	positive regulation of macromolecule biosynthetic process
GO:0051254	0.421	positive regulation of RNA metabolic process
GO:0031328	0.419	positive regulation of cellular biosynthetic process
GO:0051052	0.418	regulation of DNA metabolic process
GO:0008152	0.396	metabolic process
GO:0045893	0.393	positive regulation of DNA-templated transcription
GO:0071704	0.378	organic substance metabolic process
GO:0044238	0.375	primary metabolic process
GO:0044237	0.365	cellular metabolic process
GO:0048731	0.317	system development
GO:0006807	0.311	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.695	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]