StarFunc result for job id Q9GZV9

User Input

>input (251 residues)
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZV9	0.999	0.999	6.682E-45	251	1.000	1.000	Q9GZV9.pdb.gz	FGF23_HUMAN Fibroblast growth factor 23 OS=Homo sapiens OX=9606 GN=FGF23 PE=1 SV=1
2	AFDB:Q8VI82	0.829	0.829	4.964E-35	251	0.717	0.717	Q8VI82.pdb.gz	FGF23_RAT Fibroblast growth factor 23 OS=Rattus norvegicus OX=10116 GN=Fgf23 PE=2 SV=1
3	AFDB:Q1L8M3	0.563	0.549	2.416E-19	258	0.343	0.333	Q1L8M3.pdb.gz
4	AFDB:Q9JJN1	0.456	0.529	5.209E-14	210	0.255	0.305	Q9JJN1.pdb.gz	FGF21_MOUSE Fibroblast growth factor 21 OS=Mus musculus OX=10090 GN=Fgf21 PE=1 SV=1
5	AFDB:E1BDA6	0.498	0.592	1.416E-13	209	0.247	0.297	E1BDA6.pdb.gz	E1BDA6_BOVIN Fibroblast growth factor OS=Bos taurus OX=9913 GN=FGF21 PE=3 SV=1
6	AFDB:O95750	0.505	0.576	1.497E-13	216	0.243	0.282	O95750.pdb.gz	FGF19_HUMAN Fibroblast growth factor 19 OS=Homo sapiens OX=9606 GN=FGF19 PE=1 SV=1
7	AFDB:Q9NSA1	0.510	0.607	1.870E-13	209	0.255	0.306	Q9NSA1.pdb.gz	FGF21_HUMAN Fibroblast growth factor 21 OS=Homo sapiens OX=9606 GN=FGF21 PE=1 SV=1
8	AFDB:Q5TLF0	0.481	0.568	3.446E-13	210	0.227	0.271	Q5TLF0.pdb.gz
9	AFDB:A0A2R8QRV4	0.428	0.476	2.938E-11	225	0.195	0.218	A0A2R8QRV4.pdb.gz
10	AFDB:O35622	0.433	0.495	4.583E-11	218	0.175	0.202	O35622.pdb.gz	FGF15_MOUSE Fibroblast growth factor 15 OS=Mus musculus OX=10090 GN=Fgf15 PE=1 SV=1
11	PDB:3f1rA	0.436	0.682	6.645E-8	157	0.155	0.248	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
12	PDB:4jq0A	0.416	0.709	3.721E-7	141	0.127	0.227	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.420	0.677	5.194E-7	151	0.139	0.232	1ry7A.pdb.gz
14	PDB:6b0tA	0.394	0.214	9.120E-5	487	0.080	0.041	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4a7zA	0.388	0.122	4.322E-4	881	0.072	0.020	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.
16	PDB:7t3qA	0.321	0.047	1.833E-3	2103	0.056	0.007	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:3malA	0.327	0.433	4.460E-3	181	0.068	0.094	3malA.pdb.gz
18	PDB:6wotA	0.327	0.025	4.985E-3	4197	0.064	0.004	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
19	PDB:7ua3A	0.365	0.026	4.985E-3	4443	0.064	0.004	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:4iybA	0.386	0.653	6.581E-3	140	0.060	0.107	4iybA.pdb.gz	Macrolepiota procera ricin B-like lectin (MPL) in complex with galactose

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZV9	0.0	522	251	1.000	1.000	FGF23_HUMAN Fibroblast growth factor 23 OS=Homo sapiens OX=9606 GN=FGF23 PE=1 SV=1
2	Q8VI82	6.64e-128	364	251	0.717	0.717	FGF23_RAT Fibroblast growth factor 23 OS=Rattus norvegicus OX=10116 GN=Fgf23 PE=2 SV=1
3	Q9EPC2	5.12e-125	357	251	0.705	0.705	FGF23_MOUSE Fibroblast growth factor 23 OS=Mus musculus OX=10090 GN=Fgf23 PE=1 SV=1
4	Q5MK87	1.04e-35	129	258	0.299	0.291	Q5MK87_DANRE Fgf23 OS=Danio rerio OX=7955 GN=fgf23 PE=2 SV=1
5	Q8VI80	5.73e-22	92.4	208	0.199	0.240	Q8VI80_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf21 PE=3 SV=1
6	A0A0R4IN60	6.43e-22	92.0	209	0.243	0.292	A0A0R4IN60_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf19 PE=3 SV=1
7	Q9JJN1	1.14e-21	91.7	210	0.207	0.248	FGF21_MOUSE Fibroblast growth factor 21 OS=Mus musculus OX=10090 GN=Fgf21 PE=1 SV=1
8	E1BDA6	3.21e-19	85.1	209	0.203	0.244	E1BDA6_BOVIN Fibroblast growth factor OS=Bos taurus OX=9913 GN=FGF21 PE=3 SV=1
9	Q9NSA1	3.67e-19	84.7	209	0.195	0.234	FGF21_HUMAN Fibroblast growth factor 21 OS=Homo sapiens OX=9606 GN=FGF21 PE=1 SV=1
10	O95750	1.30e-15	75.5	216	0.219	0.255	FGF19_HUMAN Fibroblast growth factor 19 OS=Homo sapiens OX=9606 GN=FGF19 PE=1 SV=1
11	F7FG05	6.64e-14	70.9	219	0.124	0.142	F7FG05_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf21 PE=3 SV=1
12	P11487	1.21e-13	70.5	239	0.159	0.167	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
13	P05524	2.49e-13	69.7	245	0.175	0.180	FGF3_MOUSE Fibroblast growth factor 3 OS=Mus musculus OX=10090 GN=Fgf3 PE=1 SV=3
14	Q1XG76	9.03e-12	64.7	207	0.191	0.232	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
15	P48802	1.26e-11	65.1	256	0.151	0.148	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
16	P12034	2.81e-11	64.3	268	0.175	0.164	FGF5_HUMAN Fibroblast growth factor 5 OS=Homo sapiens OX=9606 GN=FGF5 PE=1 SV=4
17	O15520	4.07e-11	62.8	208	0.151	0.183	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
18	P70492	4.48e-11	62.8	215	0.151	0.177	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
19	P48805	4.86e-11	62.4	187	0.120	0.160	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
20	O42407	5.45e-11	62.4	212	0.147	0.175	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	1e-17	75.7	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237837

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369442	0.999	Klotho
2	9606.ENSP00000393312	0.999	Fibroblast growth factor receptor 1
3	9606.ENSP00000292408	0.994	Fibroblast growth factor receptor 4
4	9606.ENSP00000410294	0.993	Fibroblast growth factor receptor 2
5	9606.ENSP00000339824	0.984	Fibroblast growth factor receptor 3
6	9606.ENSP00000376465	0.982	Polypeptide N-acetylgalactosaminyltransferase 3
7	9606.ENSP00000257408	0.974	Beta-klotho
8	9606.ENSP00000263025	0.936	Mitogen-activated protein kinase 3
9	9606.ENSP00000262648	0.930	Anosmin-1
10	9606.ENSP00000368682	0.923	Phosphate-regulating neutral endopeptidase
11	9606.ENSP00000282091	0.920	Parathyroid hormone
12	9606.ENSP00000407586	0.916	GTPase HRas
13	9606.ENSP00000256078	0.910	GTPase KRas
14	9606.ENSP00000380638	0.910	Protein-tyrosine kinase 2-beta
15	9606.ENSP00000370542	0.905	Syndecan-1
16	9606.ENSP00000293328	0.904	Signal transducer and activator of transcription 5B
17	9606.ENSP00000340944	0.904	Tyrosine-protein phosphatase non-receptor type 11
18	9606.ENSP00000358548	0.903	GTPase NRas
19	9606.ENSP00000215832	0.901	Mitogen-activated protein kinase 1
20	9606.ENSP00000307046	0.900	Syndecan-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0070851	0.936	growth factor receptor binding
GO:0005104	0.814	fibroblast growth factor receptor binding
GO:0098772	0.779	molecular function regulator activity
GO:0140677	0.659	molecular function activator activity
GO:0048018	0.507	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.968	response to stimulus
GO:0008152	0.931	metabolic process
GO:0051239	0.893	regulation of multicellular organismal process
GO:0050793	0.888	regulation of developmental process
GO:0048518	0.869	positive regulation of biological process
GO:0048519	0.839	negative regulation of biological process
GO:0048523	0.827	negative regulation of cellular process
GO:0051716	0.825	cellular response to stimulus
GO:0048878	0.804	chemical homeostasis
GO:0048522	0.804	positive regulation of cellular process
GO:0098771	0.786	inorganic ion homeostasis
GO:0071704	0.780	organic substance metabolic process
GO:0019222	0.766	regulation of metabolic process
GO:2000026	0.763	regulation of multicellular organismal development
GO:0044238	0.688	primary metabolic process
GO:0007154	0.684	cell communication
GO:0007165	0.618	signal transduction
GO:0044237	0.603	cellular metabolic process
GO:0060255	0.595	regulation of macromolecule metabolic process
GO:0032502	0.592	developmental process
GO:0030278	0.557	regulation of ossification
GO:0070167	0.557	regulation of biomineral tissue development
GO:0031323	0.546	regulation of cellular metabolic process
GO:0032879	0.529	regulation of localization
GO:0030500	0.523	regulation of bone mineralization
GO:0006775	0.513	fat-soluble vitamin metabolic process
GO:0080090	0.512	regulation of primary metabolic process
GO:0048856	0.469	anatomical structure development
GO:0065009	0.461	regulation of molecular function
GO:0051049	0.458	regulation of transport
GO:0042221	0.453	response to chemical
GO:0023051	0.444	regulation of signaling
GO:0010646	0.442	regulation of cell communication
GO:0032501	0.438	multicellular organismal process
GO:0009719	0.427	response to endogenous stimulus
GO:0048583	0.418	regulation of response to stimulus
GO:0007166	0.407	cell surface receptor signaling pathway
GO:0009966	0.396	regulation of signal transduction
GO:0010468	0.394	regulation of gene expression
GO:0007167	0.391	enzyme-linked receptor protein signaling pathway
GO:0023056	0.383	positive regulation of signaling
GO:0010647	0.383	positive regulation of cell communication
GO:0044093	0.380	positive regulation of molecular function
GO:0050790	0.379	regulation of catalytic activity
GO:0071495	0.373	cellular response to endogenous stimulus
GO:0043085	0.370	positive regulation of catalytic activity
GO:0009893	0.369	positive regulation of metabolic process
GO:0042127	0.366	regulation of cell population proliferation
GO:0070848	0.359	response to growth factor
GO:1902531	0.352	regulation of intracellular signal transduction
GO:0048584	0.350	positive regulation of response to stimulus
GO:0007169	0.340	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0045595	0.335	regulation of cell differentiation
GO:0007275	0.328	multicellular organism development
GO:0009889	0.327	regulation of biosynthetic process
GO:0071363	0.318	cellular response to growth factor stimulus
GO:0031325	0.318	positive regulation of cellular metabolic process
GO:0051171	0.313	regulation of nitrogen compound metabolic process
GO:0009967	0.311	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0012505	0.947	endomembrane system
GO:0005622	0.933	intracellular anatomical structure
GO:0043226	0.932	organelle
GO:0043227	0.916	membrane-bounded organelle
GO:0005737	0.874	cytoplasm
GO:0070013	0.863	intracellular organelle lumen
GO:0043231	0.860	intracellular membrane-bounded organelle
GO:0005886	0.515	plasma membrane
GO:0005794	0.492	Golgi apparatus
GO:0005783	0.370	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]