StarFunc result for job id Q9GZX6

User Input

>input (179 residues)
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZX6	1.000	1.000	2.440E-26	179	1.000	1.000	Q9GZX6.pdb.gz	IL22_HUMAN Interleukin-22 OS=Homo sapiens OX=9606 GN=IL22 PE=1 SV=1
2	AFDB:G3V6X6	0.935	0.935	9.882E-21	179	0.754	0.754	G3V6X6.pdb.gz	G3V6X6_RAT Interleukin 22 OS=Rattus norvegicus OX=10116 GN=Il22 PE=3 SV=1
3	PDB:1ykbD	0.787	0.991	2.139E-19	142	0.793	1.000	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
4	PDB:6weoQ	0.775	0.974	1.943E-15	142	0.626	0.789	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
5	AFDB:C5VUR1	0.624	0.644	7.079E-5	173	0.207	0.214	C5VUR1.pdb.gz	C5VUR1_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il-22 PE=2 SV=1
6	AFDB:Q925S4	0.567	0.562	1.513E-4	181	0.201	0.199	Q925S4.pdb.gz	IL24_MOUSE Interleukin-24 OS=Mus musculus OX=10090 GN=Il24 PE=2 SV=1
7	AFDB:P18893	0.454	0.456	1.591E-4	178	0.196	0.197	P18893.pdb.gz	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
8	AFDB:Q5EFQ8	0.552	0.550	2.778E-4	180	0.240	0.239	Q5EFQ8.pdb.gz	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
9	PDB:6df3C	0.589	0.670	3.904E-4	155	0.151	0.174	6df3C.pdb.gz
10	AFDB:Q13007	0.599	0.528	7.647E-4	206	0.212	0.184	Q13007.pdb.gz	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
11	AFDB:Q9NPH9	0.514	0.531	1.147E-3	171	0.162	0.170	Q9NPH9.pdb.gz	IL26_HUMAN Interleukin-26 OS=Homo sapiens OX=9606 GN=IL26 PE=1 SV=1
12	AFDB:P43480	0.475	0.477	1.404E-3	178	0.212	0.213	P43480.pdb.gz	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
13	AFDB:Q9NYY1	0.602	0.611	1.902E-3	176	0.184	0.188	Q9NYY1.pdb.gz	IL20_HUMAN Interleukin-20 OS=Homo sapiens OX=9606 GN=IL20 PE=1 SV=2
14	PDB:6gg1A	0.541	0.650	4.910E-3	145	0.151	0.186	6gg1A.pdb.gz
15	PDB:4dohA	0.542	0.622	6.012E-3	153	0.151	0.176	4dohA.pdb.gz
16	PDB:5t5wC	0.502	0.576	1.831E-2	151	0.184	0.219	5t5wC.pdb.gz
17	PDB:3pivB	0.449	0.493	2.746E-2	157	0.140	0.159	3pivB.pdb.gz
18	PDB:4cniC	0.298	0.308	4.331E-2	171	0.162	0.170	4cniC.pdb.gz
19	PDB:3se4B	0.447	0.529	5.869E-2	143	0.140	0.175	3se4B.pdb.gz
20	PDB:1wu3I	0.494	0.535	6.832E-2	161	0.095	0.106	1wu3I.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZX6	2.99e-132	369	179	1.000	1.000	IL22_HUMAN Interleukin-22 OS=Homo sapiens OX=9606 GN=IL22 PE=1 SV=1
2	Q9JJY9	1.79e-103	296	179	0.782	0.782	IL22_MOUSE Interleukin-22 OS=Mus musculus OX=10090 GN=Il22 PE=1 SV=1
3	G3V6X6	4.07e-99	285	179	0.754	0.754	G3V6X6_RAT Interleukin 22 OS=Rattus norvegicus OX=10116 GN=Il22 PE=3 SV=1
4	Q198B4	1.48e-95	276	172	0.726	0.756	Q198B4_RAT Interleukin-22 (Fragment) OS=Rattus norvegicus OX=10116 GN=Il22 PE=2 SV=1
5	Q5EFQ8	3.54e-05	44.3	180	0.184	0.183	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
6	C5VUR1	3.78e-04	41.6	173	0.207	0.214	C5VUR1_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il-22 PE=2 SV=1
7	G0LWV4	6.71e-04	40.8	173	0.212	0.220	G0LWV4_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il22 PE=2 SV=1
8	Q9JI24	0.049	35.4	183	0.207	0.202	IL24_RAT Interleukin-24 OS=Rattus norvegicus OX=10116 GN=Il24 PE=2 SV=1
9	Q6A2H4	0.087	34.7	175	0.145	0.149	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
10	P18893	0.19	33.9	178	0.134	0.135	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
11	Q13007	0.27	33.5	206	0.084	0.073	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
12	Q925S4	0.75	32.0	181	0.184	0.182	IL24_MOUSE Interleukin-24 OS=Mus musculus OX=10090 GN=Il24 PE=2 SV=1
13	P29456	0.79	32.0	178	0.134	0.135	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
14	Q9NPH9	1.9	30.8	171	0.128	0.135	IL26_HUMAN Interleukin-26 OS=Homo sapiens OX=9606 GN=IL26 PE=1 SV=1
15	P03180	5.3	29.3	170	0.201	0.212	IL10H_EBVB9 Viral interleukin-10 homolog OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=BCRF1 PE=1 SV=1
16	Q9NP80	6.3	29.6	782	0.095	0.022	PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens OX=9606 GN=PNPLA8 PE=1 SV=1
17	P43480	8.4	28.9	178	0.134	0.135	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
18	Q10242	9.7	28.9	193	0.061	0.057	GNTK_SCHPO Probable gluconokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00726 IL10	0.17	22.8	Interleukin 10
2	PF14565 IL22	8.3e-79	274.1	Interleukin 22 IL-10-related T-cell-derived-inducible factor
3	PF15177 IL28A	2.8e+02	12.7	Interleukin-28A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442424

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270800	0.999	Interleukin-22 receptor subunit alpha-1
2	9606.ENSP00000290200	0.999	Interleukin-10 receptor subunit beta
3	9606.ENSP00000296980	0.999	Interleukin-22 receptor subunit alpha-2
4	9606.ENSP00000264657	0.978	Signal transducer and activator of transcription 3
5	9606.ENSP00000354394	0.953	Signal transducer and activator of transcription 1-alpha/beta
6	9606.ENSP00000293328	0.949	Signal transducer and activator of transcription 5B
7	9606.ENSP00000341208	0.949	Signal transducer and activator of transcription 5A
8	9606.ENSP00000431885	0.949	Non-receptor tyrosine-protein kinase TYK2
9	9606.ENSP00000343204	0.944	Tyrosine-protein kinase JAK1
10	9606.ENSP00000344192	0.938	Interleukin-17A
11	9606.ENSP00000227752	0.935	Interleukin-10 receptor subunit alpha
12	9606.ENSP00000337432	0.892	Interleukin-17F
13	9606.ENSP00000321345	0.890	Interleukin-23 receptor
14	9606.ENSP00000338010	0.826	Interleukin-21 receptor
15	9606.ENSP00000385675	0.826	Interleukin-6
16	9606.ENSP00000470788	0.814	Interleukin-12 receptor subunit beta-1
17	9606.ENSP00000229134	0.780	Interleukin-26
18	9606.ENSP00000306157	0.778	Interleukin-7 receptor subunit alpha
19	9606.ENSP00000263341	0.770	Interleukin-1 beta
20	9606.ENSP00000412237	0.756	Interleukin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.881	signaling receptor binding
GO:0098772	0.581	molecular function regulator activity
GO:0048018	0.505	receptor ligand activity
GO:0005125	0.451	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0042221	0.929	response to chemical
GO:0050794	0.910	regulation of cellular process
GO:0010033	0.899	response to organic substance
GO:0009987	0.877	cellular process
GO:0048518	0.877	positive regulation of biological process
GO:0048522	0.842	positive regulation of cellular process
GO:0019222	0.818	regulation of metabolic process
GO:0033993	0.795	response to lipid
GO:0009719	0.774	response to endogenous stimulus
GO:0031960	0.751	response to corticosteroid
GO:0009893	0.696	positive regulation of metabolic process
GO:0060255	0.668	regulation of macromolecule metabolic process
GO:0048583	0.607	regulation of response to stimulus
GO:0010468	0.586	regulation of gene expression
GO:0010604	0.560	positive regulation of macromolecule metabolic process
GO:0051716	0.558	cellular response to stimulus
GO:0031323	0.555	regulation of cellular metabolic process
GO:0080090	0.460	regulation of primary metabolic process
GO:0051171	0.443	regulation of nitrogen compound metabolic process
GO:0048519	0.442	negative regulation of biological process
GO:0051173	0.384	positive regulation of nitrogen compound metabolic process
GO:0031325	0.370	positive regulation of cellular metabolic process
GO:0023052	0.342	signaling
GO:0007154	0.342	cell communication
GO:0031347	0.339	regulation of defense response
GO:0006950	0.335	response to stress
GO:0007165	0.334	signal transduction
GO:0042325	0.333	regulation of phosphorylation
GO:0031399	0.315	regulation of protein modification process
GO:0032101	0.313	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.790	extracellular space
GO:0071944	0.541	cell periphery
GO:0005886	0.532	plasma membrane
GO:0005622	0.389	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]