StarFunc result for job id Q9GZX9

User Input

>input (223 residues)
MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECM
LCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVS
FPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQ
CKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZX9	1.000	1.000	2.848E-47	223	1.000	1.000	Q9GZX9.pdb.gz	TWSG1_HUMAN Twisted gastrulation protein homolog 1 OS=Homo sapiens OX=9606 GN=TWSG1 PE=1 SV=1
2	AFDB:Q9DGH0	0.568	0.582	3.154E-33	217	0.695	0.714	Q9DGH0.pdb.gz	TWS1A_DANRE Twisted gastrulation protein homolog 1-A OS=Danio rerio OX=7955 GN=twsg1a PE=2 SV=1
3	AFDB:Q98SR9	0.757	0.760	1.217E-32	222	0.619	0.622	Q98SR9.pdb.gz	TWS1B_DANRE Twisted gastrulation protein homolog 1-B OS=Danio rerio OX=7955 GN=twsg1b PE=2 SV=1
4	AFDB:Q9W494	0.609	0.533	2.779E-22	257	0.354	0.307	Q9W494.pdb.gz	Q9W494_DROME Crossveinless OS=Drosophila melanogaster OX=7227 GN=cv PE=2 SV=1
5	AFDB:P54356	0.638	0.577	5.016E-21	249	0.341	0.305	P54356.pdb.gz	TSG_DROME Protein twisted gastrulation OS=Drosophila melanogaster OX=7227 GN=tsg PE=1 SV=1
6	AFDB:Q9VZE5	0.387	0.625	2.324E-10	136	0.188	0.309	Q9VZE5.pdb.gz	Q9VZE5_DROME Shrew OS=Drosophila melanogaster OX=7227 GN=srw PE=3 SV=2
7	AFDB:P33543	0.147	0.054	1.875E-1	674	0.022	0.007	P33543.pdb.gz	TMKL1_ARATH Putative kinase-like protein TMKL1 OS=Arabidopsis thaliana OX=3702 GN=TMKL1 PE=1 SV=1
8	AFDB:F1Q5B3	0.174	0.039	9.355E-1	1500	0.081	0.012	F1Q5B3.pdb.gz
9	AFDB:F4HRC1	0.123	0.076	9.977E-1	452	0.130	0.064	F4HRC1.pdb.gz	THO5A_ARATH THO complex subunit 5A OS=Arabidopsis thaliana OX=3702 GN=THO5A PE=1 SV=1
10	AFDB:F4IGH3	0.140	0.076	1.135	513	0.040	0.018	F4IGH3.pdb.gz	F4IGH3_ARATH U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=FIO1 PE=1 SV=1
11	PDB:6pxvA	0.072	0.024	1.444	823	0.076	0.021	6pxvA.pdb.gz
12	PDB:3jd5I	0.079	0.060	2.747	311	0.058	0.042	3jd5I.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
13	PDB:3lj5A	0.100	0.040	2.747	692	0.045	0.014	3lj5A.pdb.gz
14	PDB:6oidA	0.075	0.062	3.332	289	0.027	0.021	6oidA.pdb.gz	A redox-active switch in fructosamine-3-kinases expands the regulatory repertoire of the protein kinase superfamily.
15	PDB:1ds7A	0.130	0.132	4.309	217	0.040	0.041	1ds7A.pdb.gz	Crystal structure of FMN-dependent nitroreductase from Escherichia coli B: a prodrug-activating enzyme.
16	PDB:6c3mA	0.125	0.070	4.309	465	0.036	0.017	6c3mA.pdb.gz	The role of extended Fe4S4cluster ligands in mediating sulfite reductase hemoprotein activity.
17	PDB:6yxxEC	0.120	0.078	4.595	373	0.036	0.021	6yxxEC.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:6i33B	0.122	0.036	4.900	925	0.022	0.005	6i33B.pdb.gz	Structural insights in human glycine decarboxylase and comparison with the Neanderthal variant
19	PDB:5a79A	0.084	0.102	5.572	177	0.045	0.056	5a79A.pdb.gz	Novel Inter-Subunit Contacts in Barley Stripe Mosaic Virus Revealed by Cryo-Electron Microscopy.
20	PDB:8eyyA	0.068	0.023	5.572	775	0.081	0.023	8eyyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZX9	6.67e-167	460	223	1.000	1.000	TWSG1_HUMAN Twisted gastrulation protein homolog 1 OS=Homo sapiens OX=9606 GN=TWSG1 PE=1 SV=1
2	Q9EP52	2.03e-151	421	222	0.933	0.937	TWSG1_MOUSE Twisted gastrulation protein homolog 1 OS=Mus musculus OX=10090 GN=Twsg1 PE=1 SV=1
3	Q9DGH0	4.77e-108	311	217	0.673	0.691	TWS1A_DANRE Twisted gastrulation protein homolog 1-A OS=Danio rerio OX=7955 GN=twsg1a PE=2 SV=1
4	Q98SR9	8.39e-101	293	222	0.605	0.608	TWS1B_DANRE Twisted gastrulation protein homolog 1-B OS=Danio rerio OX=7955 GN=twsg1b PE=2 SV=1
5	Q9W494	1.78e-40	140	257	0.377	0.327	Q9W494_DROME Crossveinless OS=Drosophila melanogaster OX=7227 GN=cv PE=2 SV=1
6	P54356	1.70e-34	125	249	0.350	0.313	TSG_DROME Protein twisted gastrulation OS=Drosophila melanogaster OX=7227 GN=tsg PE=1 SV=1
7	Q9VZE5	4.58e-15	71.2	136	0.197	0.324	Q9VZE5_DROME Shrew OS=Drosophila melanogaster OX=7227 GN=srw PE=3 SV=2
8	F4JSY9	2.3	31.6	378	0.152	0.090	F4JSY9_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=PDE191 PE=1 SV=1
9	P34909	2.7	31.6	587	0.112	0.043	NOT4_YEAST General negative regulator of transcription subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOT2 PE=1 SV=1
10	Q9SZL6	2.7	31.2	333	0.152	0.102	MTEF6_ARATH Transcription termination factor MTERF6, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTERF6 PE=2 SV=1
11	Q8ZR06	3.8	30.4	190	0.054	0.063	PAGP_SALTY Lipid A acyltransferase PagP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=pagP PE=1 SV=1
12	Q8XBR9	4.2	30.4	186	0.058	0.070	PAGP_ECO57 Lipid A palmitoyltransferase PagP OS=Escherichia coli O157:H7 OX=83334 GN=pagP PE=1 SV=1
13	P22149	4.4	30.8	690	0.058	0.019	AFT1_YEAST Iron-regulated transcriptional activator AFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04668 Tsg	4.3e-43	158.5	Twisted gastrulation (Tsg) protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204604	0.992	Chordin
2	9606.ENSP00000252809	0.878	Growth differentiation factor 15
3	9606.ENSP00000245451	0.877	Bone morphogenetic protein 4
4	9606.ENSP00000263671	0.805	Chordin-related protein 2 variant III
5	9606.ENSP00000305714	0.772	Bone morphogenetic protein 1
6	9606.ENSP00000297161	0.769	BMP-binding endothelial regulator protein
7	9606.ENSP00000334186	0.714	Von Willebrand factor C and EGF domain-containing protein
8	9606.ENSP00000368104	0.712	Bone morphogenetic protein 2
9	9606.ENSP00000359866	0.706	Bone morphogenetic protein 5
10	9606.ENSP00000381220	0.642	HD domain containing 2
11	9606.ENSP00000283147	0.639	Bone morphogenetic protein 6
12	9606.ENSP00000349547	0.631	Ras association domain-containing protein 1
13	9606.ENSP00000361112	0.616	Chordin-like protein 1
14	9606.ENSP00000379204	0.616	Bone morphogenetic protein 7
15	9606.ENSP00000471894	0.607	Hepcidin
16	9606.ENSP00000442304	0.605	Erythroferrone
17	9606.ENSP00000243347	0.560	Tumor necrosis factor-inducible gene 6 protein
18	9606.ENSP00000418915	0.558	Cyclin-dependent kinase inhibitor 2A
19	9606.ENSP00000269305	0.556	Cellular tumor antigen p53
20	9606.ENSP00000418960	0.556	Breast cancer type 1 susceptibility protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050431	0.996	transforming growth factor beta binding
GO:1901681	0.787	sulfur compound binding
GO:0005539	0.779	glycosaminoglycan binding
GO:0008201	0.721	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.995	cellular response to stimulus
GO:0048518	0.995	positive regulation of biological process
GO:0048523	0.995	negative regulation of cellular process
GO:0070848	0.988	response to growth factor
GO:0009966	0.988	regulation of signal transduction
GO:0048522	0.985	positive regulation of cellular process
GO:0007178	0.985	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090092	0.984	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032501	0.969	multicellular organismal process
GO:0048856	0.968	anatomical structure development
GO:0071363	0.958	cellular response to growth factor stimulus
GO:0007275	0.951	multicellular organism development
GO:0031323	0.947	regulation of cellular metabolic process
GO:0080090	0.946	regulation of primary metabolic process
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0050793	0.937	regulation of developmental process
GO:0090100	0.912	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071773	0.902	cellular response to BMP stimulus
GO:0009893	0.895	positive regulation of metabolic process
GO:0051239	0.874	regulation of multicellular organismal process
GO:0060255	0.865	regulation of macromolecule metabolic process
GO:0008285	0.857	negative regulation of cell population proliferation
GO:0042325	0.857	regulation of phosphorylation
GO:0001932	0.853	regulation of protein phosphorylation
GO:0030155	0.839	regulation of cell adhesion
GO:0060393	0.831	regulation of pathway-restricted SMAD protein phosphorylation
GO:0007162	0.824	negative regulation of cell adhesion
GO:0051241	0.822	negative regulation of multicellular organismal process
GO:0048731	0.810	system development
GO:0045595	0.796	regulation of cell differentiation
GO:0010604	0.780	positive regulation of macromolecule metabolic process
GO:0048585	0.774	negative regulation of response to stimulus
GO:0031325	0.760	positive regulation of cellular metabolic process
GO:0010468	0.714	regulation of gene expression
GO:0022407	0.700	regulation of cell-cell adhesion
GO:0071559	0.687	response to transforming growth factor beta
GO:0051173	0.663	positive regulation of nitrogen compound metabolic process
GO:0002683	0.645	negative regulation of immune system process
GO:0031401	0.637	positive regulation of protein modification process
GO:0090287	0.636	regulation of cellular response to growth factor stimulus
GO:0022408	0.627	negative regulation of cell-cell adhesion
GO:0010605	0.625	negative regulation of macromolecule metabolic process
GO:0009968	0.602	negative regulation of signal transduction
GO:0045937	0.599	positive regulation of phosphate metabolic process
GO:0002694	0.590	regulation of leukocyte activation
GO:0050863	0.571	regulation of T cell activation
GO:0030510	0.564	regulation of BMP signaling pathway
GO:0051250	0.559	negative regulation of lymphocyte activation
GO:1903037	0.546	regulation of leukocyte cell-cell adhesion
GO:0001934	0.546	positive regulation of protein phosphorylation
GO:0070663	0.540	regulation of leukocyte proliferation
GO:1903038	0.535	negative regulation of leukocyte cell-cell adhesion
GO:0070664	0.530	negative regulation of leukocyte proliferation
GO:0050868	0.529	negative regulation of T cell activation
GO:0042129	0.520	regulation of T cell proliferation
GO:0050672	0.491	negative regulation of lymphocyte proliferation
GO:0048513	0.468	animal organ development
GO:0046634	0.462	regulation of alpha-beta T cell activation
GO:0045667	0.453	regulation of osteoblast differentiation
GO:0071560	0.434	cellular response to transforming growth factor beta stimulus
GO:0042130	0.422	negative regulation of T cell proliferation
GO:0090101	0.398	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009888	0.393	tissue development
GO:0051172	0.392	negative regulation of nitrogen compound metabolic process
GO:0009889	0.386	regulation of biosynthetic process
GO:0010556	0.378	regulation of macromolecule biosynthetic process
GO:0019219	0.372	regulation of nucleobase-containing compound metabolic process
GO:0046636	0.372	negative regulation of alpha-beta T cell activation
GO:0031326	0.364	regulation of cellular biosynthetic process
GO:0051252	0.359	regulation of RNA metabolic process
GO:2001141	0.352	regulation of RNA biosynthetic process
GO:0048869	0.351	cellular developmental process
GO:0046640	0.317	regulation of alpha-beta T cell proliferation
GO:0045935	0.315	positive regulation of nucleobase-containing compound metabolic process
GO:0009653	0.305	anatomical structure morphogenesis
GO:0006355	0.301	regulation of DNA-templated transcription
GO:0008152	0.300	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.774	intracellular anatomical structure
GO:0043226	0.571	organelle
GO:0043229	0.549	intracellular organelle
GO:0043227	0.547	membrane-bounded organelle
GO:0043231	0.409	intracellular membrane-bounded organelle
GO:0005737	0.358	cytoplasm
GO:0070013	0.356	intracellular organelle lumen
GO:0012505	0.308	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]