StarFunc result for job id Q9GZZ1

User Input

>input (169 residues)
MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVC
CRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESA
IDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PGB6	0.943	0.943	2.106E-32	169	0.988	0.988	Q6PGB6.pdb.gz	NAA50_MOUSE N-alpha-acetyltransferase 50 OS=Mus musculus OX=10090 GN=Naa50 PE=1 SV=1
2	PDB:2ob0C	0.913	0.929	1.124E-29	166	0.982	1.000	2ob0C.pdb.gz	Structure of Human MAK3 homolog
3	AFDB:Q9NHD5	0.918	0.844	3.535E-27	184	0.716	0.658	Q9NHD5.pdb.gz	SAN_DROME Probable N-acetyltransferase san OS=Drosophila melanogaster OX=7227 GN=san PE=1 SV=1
4	AFDB:Q9LFM3	0.875	0.900	4.028E-21	164	0.485	0.500	Q9LFM3.pdb.gz	Q9LFM3_ARATH Acyl-CoA N-acyltransferases (NAT) superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g11340 PE=1 SV=1
5	PDB:6z00A	0.830	0.897	1.502E-18	156	0.485	0.526	6z00A.pdb.gz	Structural and functional characterization of the N-terminal acetyltransferase Naa50.
6	AFDB:C9J5D1	0.465	0.601	2.302E-16	129	0.734	0.961	C9J5D1.pdb.gz	C9J5D1_HUMAN N-alpha-acetyltransferase 50, NatE catalytic subunit OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1
7	AFDB:Q9P6R8	0.845	0.278	3.836E-15	533	0.355	0.113	Q9P6R8.pdb.gz	CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf24 PE=1 SV=1
8	AFDB:O74519	0.758	0.883	2.116E-13	144	0.272	0.319	O74519.pdb.gz	YCPD_SCHPO Uncharacterized N-acetyltransferase C663.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC663.13c PE=3 SV=1
9	AFDB:Q980R9	0.805	0.815	8.151E-12	167	0.249	0.251	Q980R9.pdb.gz	NAT_SACS2 N-alpha-acetyltransferase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=ard1 PE=1 SV=2
10	AFDB:O80438	0.820	0.733	9.754E-12	190	0.207	0.184	O80438.pdb.gz	MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana OX=3702 GN=MAK3 PE=1 SV=1
11	AFDB:O74311	0.780	0.872	1.167E-11	150	0.231	0.260	O74311.pdb.gz	NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa30 PE=1 SV=1
12	AFDB:Q9FKI4	0.825	0.733	1.483E-11	192	0.243	0.214	Q9FKI4.pdb.gz	NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
13	PDB:5c88A	0.795	0.847	1.766E-11	158	0.243	0.259	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
14	PDB:7l1kA	0.803	0.904	7.888E-11	149	0.237	0.268	7l1kA.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
15	PDB:6c95B	0.780	0.817	2.460E-10	161	0.213	0.224	6c95B.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
16	PDB:6ygbA	0.801	0.848	3.318E-10	159	0.225	0.239	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
17	PDB:6hd5u	0.779	0.571	3.970E-10	235	0.254	0.183	6hd5u.pdb.gz
18	PDB:5hgzA	0.778	0.632	1.166E-9	211	0.219	0.175	5hgzA.pdb.gz	Structure and function of human Naa60 (NatF), a Golgi-localized bi-functional acetyltransferase
19	PDB:4hnxB	0.676	0.551	1.482E-9	213	0.237	0.188	4hnxB.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
20	PDB:6hd7v	0.769	0.804	2.122E-9	161	0.249	0.261	6hd7v.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZZ1	1.90e-125	351	169	1.000	1.000	NAA50_HUMAN N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1
2	Q6PGB6	1.73e-124	348	169	0.988	0.988	NAA50_MOUSE N-alpha-acetyltransferase 50 OS=Mus musculus OX=10090 GN=Naa50 PE=1 SV=1
3	E7EQ69	6.96e-123	344	168	0.994	1.000	E7EQ69_HUMAN N-alpha-acetyltransferase 50, NatE catalytic subunit OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1
4	Q6DBY2	4.15e-112	317	168	0.923	0.929	NAA50_DANRE N-alpha-acetyltransferase 50 OS=Danio rerio OX=7955 GN=naa50 PE=1 SV=1
5	Q9NHD5	1.46e-91	266	184	0.716	0.658	SAN_DROME Probable N-acetyltransferase san OS=Drosophila melanogaster OX=7227 GN=san PE=1 SV=1
6	C9J5D1	1.30e-84	246	129	0.763	1.000	C9J5D1_HUMAN N-alpha-acetyltransferase 50, NatE catalytic subunit OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1
7	Q9LFM3	4.32e-54	170	164	0.485	0.500	Q9LFM3_ARATH Acyl-CoA N-acyltransferases (NAT) superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g11340 PE=1 SV=1
8	C9JZU6	3.02e-31	108	57	0.337	1.000	C9JZU6_HUMAN N-alpha-acetyltransferase 50, NatE catalytic subunit (Fragment) OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1
9	Q9P6R8	2.79e-24	100	533	0.331	0.105	CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf24 PE=1 SV=1
10	O74519	1.77e-17	76.6	144	0.290	0.340	YCPD_SCHPO Uncharacterized N-acetyltransferase C663.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC663.13c PE=3 SV=1
11	Q980R9	1.11e-11	61.6	167	0.272	0.275	NAT_SACS2 N-alpha-acetyltransferase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=ard1 PE=1 SV=2
12	Q9LFD8	8.65e-11	60.8	273	0.213	0.132	Q9LFD8_ARATH histone acetyltransferase OS=Arabidopsis thaliana OX=3702 GN=At5g16800 PE=1 SV=1
13	O74311	2.20e-09	55.5	150	0.260	0.293	NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa30 PE=1 SV=1
14	Q9FKI4	2.69e-09	55.8	192	0.243	0.214	NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
15	Q9M8T9	8.62e-09	55.1	247	0.207	0.142	MCC1_ARATH Histone acetyltransferase MCC1 OS=Arabidopsis thaliana OX=3702 GN=MCC1 PE=2 SV=1
16	O61219	5.00e-08	52.4	182	0.213	0.198	DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans OX=6239 GN=daf-31 PE=2 SV=1
17	I6YG32	8.87e-08	51.2	158	0.154	0.165	RIMI_MYCTU N-alpha-acetyltransferase RimI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rimI PE=1 SV=1
18	Q50708	8.87e-08	51.2	158	0.154	0.165	Q50708_MYCTO Acetyltransferase, GNAT family OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3529 PE=4 SV=1
19	Q147X3	1.05e-07	52.4	362	0.178	0.083	NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30 PE=1 SV=1
20	P07347	2.44e-07	50.8	238	0.189	0.134	ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	1.2e-10	53.0	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	0.00014	33.2	Acetyltransferase (GNAT) domain
3	PF13302 Acetyltransf_3	89	15.2	Acetyltransferase (GNAT) domain
4	PF13420 Acetyltransf_4	0.042	25.3	Acetyltransferase (GNAT) domain
5	PF13508 Acetyltransf_7	1.5e-06	39.8	Acetyltransferase (GNAT) domain
6	PF13523 Acetyltransf_8	34	15.5	Acetyltransferase (GNAT) domain
7	PF13527 Acetyltransf_9	5.9	18.5	Acetyltransferase (GNAT) domain
8	PF08445 FR47	0.72	21.2	FR47-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008582316.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008580215.1	0.999	N-alpha-acetyltransferase 15, NatA auxiliary subunit
2	482537.XP_008576621.1	0.992	N-alpha-acetyltransferase 10
3	482537.XP_008589119.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 18 Proteins, and 88% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
4	482537.XP_008586109.1	0.978	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
5	482537.XP_008592012.1	0.978	N-alpha-acetyltransferase 16, NatA auxiliary subunit-like
6	482537.XP_008586473.1	0.963	N-alpha-acetyltransferase 20 isoform X1
7	482537.XP_008574884.1	0.958	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008585795.1	0.947	N-alpha-acetyltransferase 35, NatC auxiliary subunit
9	482537.XP_008593085.1	0.947	N-alpha-acetyltransferase 35, NatC auxiliary subunit-like
10	482537.XP_008588434.1	0.939	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008570921.1	0.933	N-alpha-acetyltransferase 25, NatB auxiliary subunit-like
12	482537.XP_008582188.1	0.933	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 14 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
13	482537.XP_008577259.1	0.927	SAGA-associated factor 29 homolog
14	482537.XP_008587474.1	0.900	N-alpha-acetyltransferase 30
15	482537.XP_008575703.1	0.898	Transcriptional adapter 3
16	482537.XP_008570265.1	0.864	Protein Dr1
17	482537.XP_008590479.1	0.840	Small nuclear ribonucleoprotein E
18	482537.XP_008566962.1	0.820	DNA polymerase epsilon subunit 3
19	482537.XP_008579199.1	0.816	Methionine aminopeptidase 1 isoform X1
20	482537.XP_008574808.1	0.810	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 5 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004596	1.000	peptide alpha-N-acetyltransferase activity
GO:0004402	0.991	histone acetyltransferase activity
GO:0010485	0.831	histone H4 acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0010467	0.996	gene expression
GO:0031365	0.987	N-terminal protein amino acid modification
GO:0051604	0.982	protein maturation
GO:0043543	0.970	protein acylation
GO:0006473	0.957	protein acetylation
GO:0009987	0.917	cellular process
GO:0071840	0.319	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0005737	0.999	cytoplasm
GO:0005829	0.993	cytosol
GO:0005730	0.989	nucleolus
GO:0032991	0.988	protein-containing complex
GO:0005654	0.950	nucleoplasm
GO:0005576	0.939	extracellular region
GO:1903561	0.879	extracellular vesicle
GO:0070062	0.870	extracellular exosome
GO:1902494	0.802	catalytic complex
GO:0031248	0.685	protein acetyltransferase complex
GO:0031414	0.531	N-terminal protein acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:21992	0.991	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.991	histone acetyltransferase.

[back to server]