StarFunc result for job id Q9GZZ6

User Input

>input (450 residues)
MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
KADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGH
QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQS
RPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK
RLARVMDRFFLAIFFSMALVMSLLVLVQAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZZ6	1.000	1.000	1.309E-82	450	1.000	1.000	Q9GZZ6.pdb.gz	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
2	AFDB:Q9I8C7	0.917	0.913	1.762E-62	452	0.651	0.648	Q9I8C7.pdb.gz	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
3	AFDB:Q9PTS8	0.877	0.815	2.441E-58	484	0.560	0.521	Q9PTS8.pdb.gz	ACHA9_CHICK Neuronal acetylcholine receptor subunit alpha-9 OS=Gallus gallus OX=9031 GN=CHRNA9 PE=1 SV=1
4	AFDB:G3X8Z7	0.903	0.850	2.412E-57	479	0.567	0.532	G3X8Z7.pdb.gz	G3X8Z7_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 9 OS=Mus musculus OX=10090 GN=Chrna9 PE=3 SV=1
5	AFDB:F1P4Y5	0.813	0.731	2.234E-46	502	0.407	0.365	F1P4Y5.pdb.gz
6	AFDB:A0A0R4IV47	0.828	0.736	3.244E-46	510	0.407	0.359	A0A0R4IV47.pdb.gz
7	AFDB:Q03481	0.801	0.708	4.711E-46	511	0.396	0.348	Q03481.pdb.gz	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
8	AFDB:P36544	0.814	0.733	5.830E-46	502	0.404	0.363	P36544.pdb.gz	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
9	AFDB:Q15825	0.839	0.766	9.931E-46	494	0.358	0.326	Q15825.pdb.gz	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
10	AFDB:P32297	0.831	0.743	1.784E-45	505	0.369	0.329	P32297.pdb.gz	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
11	PDB:6i53B	0.598	0.785	1.320E-22	338	0.144	0.192	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.582	0.741	1.703E-21	349	0.127	0.163	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:4aq5E	0.539	0.642	3.227E-21	370	0.244	0.297	4aq5E.pdb.gz
14	PDB:2w8gC	0.428	0.860	2.415E-19	217	0.131	0.272	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
15	PDB:4hfcA	0.554	0.784	4.339E-19	311	0.107	0.154	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
16	PDB:4afhA	0.425	0.872	2.120E-17	213	0.120	0.254	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
17	PDB:7kuyE	0.536	0.695	2.358E-17	338	0.129	0.172	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
18	PDB:7l6qA	0.485	0.686	3.527E-15	311	0.116	0.167	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.431	0.644	1.776E-11	288	0.109	0.170	6zgdA.pdb.gz
20	PDB:4wz9B	0.101	0.064	1.999E-3	887	0.047	0.024	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RX82	0.0	798	447	0.907	0.913	B2RX82_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 10 OS=Mus musculus OX=10090 GN=Chrna10 PE=2 SV=1
2	G3X8Z7	0.0	525	479	0.556	0.522	G3X8Z7_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 9 OS=Mus musculus OX=10090 GN=Chrna9 PE=3 SV=1
3	P43144	0.0	526	479	0.560	0.526	ACHA9_RAT Neuronal acetylcholine receptor subunit alpha-9 OS=Rattus norvegicus OX=10116 GN=Chrna9 PE=1 SV=2
4	Q9GZZ6	0.0	914	450	1.000	1.000	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
5	Q9I8C7	0.0	592	452	0.656	0.653	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
6	Q9JLB5	0.0	810	447	0.900	0.906	ACH10_RAT Neuronal acetylcholine receptor subunit alpha-10 OS=Rattus norvegicus OX=10116 GN=Chrna10 PE=1 SV=1
7	Q9PTS8	0.0	535	484	0.571	0.531	ACHA9_CHICK Neuronal acetylcholine receptor subunit alpha-9 OS=Gallus gallus OX=9031 GN=CHRNA9 PE=1 SV=1
8	Q9UGM1	0.0	523	479	0.558	0.524	ACHA9_HUMAN Neuronal acetylcholine receptor subunit alpha-9 OS=Homo sapiens OX=9606 GN=CHRNA9 PE=1 SV=2
9	A0A0J9YUW0	2.54e-120	353	258	0.356	0.620	A0A0J9YUW0_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 9 (Fragment) OS=Mus musculus OX=10090 GN=Chrna9 PE=3 SV=3
10	P22770	4.04e-109	333	502	0.404	0.363	ACHA7_CHICK Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1
11	Q05941	7.47e-109	332	502	0.402	0.361	ACHA7_RAT Neuronal acetylcholine receptor subunit alpha-7 OS=Rattus norvegicus OX=10116 GN=Chrna7 PE=1 SV=2
12	P49582	8.78e-109	332	502	0.402	0.361	ACHA7_MOUSE Neuronal acetylcholine receptor subunit alpha-7 OS=Mus musculus OX=10090 GN=Chrna7 PE=1 SV=1
13	P36544	3.17e-108	331	502	0.407	0.365	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
14	Q866A2	1.55e-107	329	502	0.404	0.363	ACHA7_MACMU Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1
15	P32297	1.12e-103	319	505	0.351	0.313	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
16	Q03481	1.35e-103	319	511	0.409	0.360	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
17	Q9R0W9	3.84e-103	318	494	0.356	0.324	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
18	M9PDC9	5.39e-103	317	499	0.367	0.331	M9PDC9_DROME Nicotinic acetylcholine receptor alpha4, isoform G OS=Drosophila melanogaster OX=7227 GN=nAChRalpha4 PE=3 SV=1
19	Q15825	1.68e-102	316	494	0.351	0.320	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
20	Q8R4G9	2.49e-102	316	499	0.353	0.319	ACHA3_MOUSE Neuronal acetylcholine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Chrna3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	3.1e-60	214.8	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	2.7e-37	140.7	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250699

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337103	0.738	Choline O-acetyltransferase
2	9606.ENSP00000340125	0.631	Protein phosphatase 1 regulatory subunit 17
3	9606.ENSP00000278243	0.626	Post-GPI attachment to proteins factor 2
4	9606.ENSP00000367214	0.612	Glutaredoxin domain-containing cysteine-rich protein 2
5	9606.ENSP00000246515	0.607	Secreted Ly-6/uPAR-related protein 1
6	9606.ENSP00000262916	0.606	Potassium voltage-gated channel subfamily KQT member 4
7	9606.ENSP00000424711	0.601	Clarin-2
8	9606.ENSP00000236671	0.581	Cathepsin D
9	9606.ENSP00000358994	0.567	Unconventional myosin-VI
10	9606.ENSP00000312624	0.565	Telethonin
11	9606.ENSP00000297784	0.562	Transmembrane channel-like protein 1
12	9606.ENSP00000329158	0.547	Clarin-1
13	9606.ENSP00000380258	0.508	ADP-ribosyltransferase 5
14	9606.ENSP00000358430	0.506	Beta-tectorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1904315	1.000	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005515	0.998	protein binding
GO:0005261	0.995	monoatomic cation channel activity
GO:0005231	0.995	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0022848	0.985	acetylcholine-gated monoatomic cation-selective channel activity
GO:0004888	0.887	transmembrane signaling receptor activity
GO:0005102	0.644	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0042391	0.996	regulation of membrane potential
GO:0051899	0.989	membrane depolarization
GO:0007267	0.985	cell-cell signaling
GO:0007271	0.976	synaptic transmission, cholinergic
GO:0050789	0.865	regulation of biological process
GO:0050794	0.774	regulation of cellular process
GO:0050896	0.633	response to stimulus
GO:0032501	0.620	multicellular organismal process
GO:0007605	0.330	sensory perception of sound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043226	0.970	organelle
GO:0120025	0.791	plasma membrane bounded cell projection
GO:0005622	0.468	intracellular anatomical structure
GO:0045202	0.444	synapse
GO:0032991	0.411	protein-containing complex
GO:0005737	0.409	cytoplasm
GO:0098590	0.399	plasma membrane region
GO:0043005	0.395	neuron projection
GO:0098794	0.305	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]