StarFunc result for job id Q9GZZ7

User Input

>input (299 residues)
MVRCLGPALLLLLLLGSASSVGGNRCVDAAEACTADARCQRLRSEYVAQCLGRAAQGGCP
RARCRRALRRFFARGPPALTHALLFCPCAGPACAERRRQTFVPSCAFSGPGPAPPSCLEP
LNFCERSRVCRCARAAAGPWRGWGRGLSPAHRPPAAQASPPGLSGLVHPSAQRPRRLPAG
PGRPLPARLRGPRGVPAGTAVTPNYVDNVSARVAPWCDCGASGNRREDCEAFRGLFTRNR
CLDGAIQAFASGWPPVLLDQLNPQGDPEHSLLQVSSTGRALERRSLLSILPVLALPALL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GZZ7	1.000	1.000	4.182E-49	299	1.000	1.000	Q9GZZ7.pdb.gz	GFRA4_HUMAN GDNF family receptor alpha-4 OS=Homo sapiens OX=9606 GN=GFRA4 PE=1 SV=2
2	AFDB:Q9JJT2	0.553	0.629	2.869E-21	260	0.559	0.642	Q9JJT2.pdb.gz	GFRA4_MOUSE GDNF family receptor alpha-4 OS=Mus musculus OX=10090 GN=Gfra4 PE=2 SV=2
3	AFDB:Q9EPI2	0.546	0.594	1.411E-19	273	0.562	0.615	Q9EPI2.pdb.gz	GFRA4_RAT GDNF family receptor alpha-4 OS=Rattus norvegicus OX=10116 GN=Gfra4 PE=2 SV=2
4	AFDB:P97785	0.529	0.349	2.145E-11	468	0.284	0.182	P97785.pdb.gz	GFRA1_MOUSE GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2
5	AFDB:E7F4G1	0.518	0.347	2.128E-10	458	0.284	0.186	E7F4G1.pdb.gz	E7F4G1_DANRE GDNF family receptor alpha 3 OS=Danio rerio OX=7955 GN=gfra3 PE=2 SV=1
6	PDB:6q2nC	0.510	0.739	3.922E-10	200	0.261	0.390	6q2nC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
7	AFDB:K9J968	0.496	0.408	4.739E-10	369	0.261	0.211	K9J968.pdb.gz	K9J968_HUMAN GDNF family receptor alpha-3 variant OS=Homo sapiens OX=9606 GN=GDNFR3 PE=2 SV=1
8	AFDB:O00451	0.511	0.340	1.000E-9	464	0.298	0.192	O00451.pdb.gz	GFRA2_HUMAN GDNF family receptor alpha-2 OS=Homo sapiens OX=9606 GN=GFRA2 PE=1 SV=2
9	AFDB:O60609	0.466	0.356	6.140E-9	400	0.264	0.198	O60609.pdb.gz	GFRA3_HUMAN GDNF family receptor alpha-3 OS=Homo sapiens OX=9606 GN=GFRA3 PE=1 SV=2
10	PDB:6gl7C	0.501	0.505	6.291E-9	297	0.271	0.273	6gl7C.pdb.gz
11	PDB:6q2sC	0.472	0.684	7.383E-9	199	0.234	0.352	6q2sC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
12	AFDB:A0A0B4K6A2	0.300	0.086	1.377E-2	1168	0.140	0.036	A0A0B4K6A2.pdb.gz	A0A0B4K6A2_DROME Glial cell line-derived neurotrophic family receptor-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Gfrl PE=3 SV=1
13	PDB:7rhqG	0.208	0.355	1.258E-1	160	0.094	0.175	7rhqG.pdb.gz	Structural basis for catalyzed assembly of the Sonic hedgehog-Patched1 signaling complex.
14	AFDB:Q9ZT63	0.109	0.093	1.155	398	0.117	0.088	Q9ZT63.pdb.gz	MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana OX=3702 GN=MTP1 PE=1 SV=2
15	PDB:7f0rF	0.132	0.139	3.093	278	0.074	0.079	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
16	PDB:2bb5A	0.106	0.082	3.262	409	0.070	0.051	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
17	PDB:7td3R	0.101	0.103	4.740	292	0.040	0.041	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
18	PDB:7r5jB0	0.104	0.025	4.999	1748	0.070	0.012	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:2a1tC	0.097	0.080	5.274	388	0.057	0.044	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
20	PDB:6z3mP	0.127	0.367	5.274	76	0.050	0.197	6z3mP.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9GZZ7	0.0	575	299	1.000	1.000	GFRA4_HUMAN GDNF family receptor alpha-4 OS=Homo sapiens OX=9606 GN=GFRA4 PE=1 SV=2
2	Q9EPI2	1.40e-77	239	273	0.538	0.590	GFRA4_RAT GDNF family receptor alpha-4 OS=Rattus norvegicus OX=10116 GN=Gfra4 PE=2 SV=2
3	Q9JJT2	2.09e-71	223	260	0.572	0.658	GFRA4_MOUSE GDNF family receptor alpha-4 OS=Mus musculus OX=10090 GN=Gfra4 PE=2 SV=2
4	Q62997	6.63e-40	147	468	0.291	0.186	GFRA1_RAT GDNF family receptor alpha-1 OS=Rattus norvegicus OX=10116 GN=Gfra1 PE=1 SV=1
5	P97785	7.43e-40	146	468	0.284	0.182	GFRA1_MOUSE GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2
6	P56159	7.70e-40	146	465	0.284	0.183	GFRA1_HUMAN GDNF family receptor alpha-1 OS=Homo sapiens OX=9606 GN=GFRA1 PE=1 SV=2
7	A0A8I6A8G6	8.29e-39	141	331	0.304	0.275	A0A8I6A8G6_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
8	O08842	2.58e-36	137	464	0.284	0.183	GFRA2_MOUSE GDNF family receptor alpha-2 OS=Mus musculus OX=10090 GN=Gfra2 PE=1 SV=2
9	O35977	3.66e-36	136	464	0.288	0.185	O35977_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=2 SV=1
10	A0A8I6B3J9	5.37e-36	137	506	0.288	0.170	A0A8I6B3J9_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
11	B0S6A6	1.13e-35	135	495	0.291	0.176	B0S6A6_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfra2 PE=3 SV=1
12	O00451	2.12e-34	132	464	0.284	0.183	GFRA2_HUMAN GDNF family receptor alpha-2 OS=Homo sapiens OX=9606 GN=GFRA2 PE=1 SV=2
13	Q98TT8	2.91e-34	132	481	0.264	0.164	Q98TT8_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1b PE=2 SV=2
14	Q98TT9	5.51e-33	128	472	0.264	0.167	Q98TT9_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1a PE=1 SV=2
15	E7F4G1	2.43e-32	126	458	0.268	0.175	E7F4G1_DANRE GDNF family receptor alpha 3 OS=Danio rerio OX=7955 GN=gfra3 PE=2 SV=1
16	K9J968	1.11e-22	98.6	369	0.271	0.220	K9J968_HUMAN GDNF family receptor alpha-3 variant OS=Homo sapiens OX=9606 GN=GDNFR3 PE=2 SV=1
17	O60609	1.01e-21	96.3	400	0.261	0.195	GFRA3_HUMAN GDNF family receptor alpha-3 OS=Homo sapiens OX=9606 GN=GFRA3 PE=1 SV=2
18	O35118	1.13e-20	93.2	397	0.281	0.212	GFRA3_MOUSE GDNF family receptor alpha-3 OS=Mus musculus OX=10090 GN=Gfra3 PE=2 SV=1
19	F7F1M3	6.24e-20	91.3	402	0.254	0.189	F7F1M3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=3 SV=1
20	Q6AXR3	1.02e-19	90.5	397	0.254	0.191	Q6AXR3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02351 GDNF	3.9e-30	115.8	GDNF/GAS1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245810	0.976	Persephin
2	9606.ENSP00000347942	0.926	Proto-oncogene tyrosine-protein kinase receptor Ret
3	9606.ENSP00000309591	0.902	cAMP-dependent protein kinase catalytic subunit alpha
4	9606.ENSP00000359719	0.902	cAMP-dependent protein kinase catalytic subunit beta
5	9606.ENSP00000366488	0.902	cAMP-dependent protein kinase catalytic subunit gamma
6	9606.ENSP00000387435	0.888	Artemin
7	9606.ENSP00000302648	0.871	Neurturin
8	9606.ENSP00000409007	0.790	Glial cell line-derived neurotrophic factor
9	9606.ENSP00000372160	0.771	Docking protein 6
10	9606.ENSP00000434033	0.684	Rap1 GTPase-activating protein 1
11	9606.ENSP00000262593	0.662	Docking protein 5
12	9606.ENSP00000364995	0.642	SHC-transforming protein 3
13	9606.ENSP00000233668	0.629	Docking protein 1
14	9606.ENSP00000274721	0.623	GDNF family receptor alpha-3
15	9606.ENSP00000362680	0.621	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000276420	0.616	Docking protein 2
17	9606.ENSP00000344277	0.611	Docking protein 4
18	9606.ENSP00000244007	0.608	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
19	9606.ENSP00000262741	0.608	Phosphatidylinositol 3-kinase regulatory subunit gamma
20	9606.ENSP00000348099	0.608	PDZ and LIM domain protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	0.999	protein binding
GO:0140375	0.930	immune receptor activity
GO:0004896	0.915	cytokine receptor activity
GO:0016167	0.705	glial cell-derived neurotrophic factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0050896	0.958	response to stimulus
GO:0007165	0.936	signal transduction
GO:0048519	0.790	negative regulation of biological process
GO:0007166	0.784	cell surface receptor signaling pathway
GO:0007167	0.693	enzyme-linked receptor protein signaling pathway
GO:0032501	0.582	multicellular organismal process
GO:0019222	0.481	regulation of metabolic process
GO:0060255	0.429	regulation of macromolecule metabolic process
GO:0007169	0.417	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048523	0.364	negative regulation of cellular process
GO:0048856	0.301	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005576	0.612	extracellular region
GO:0005829	0.469	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]