StarFunc result for job id Q9H000

User Input

>input (416 residues)
MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSA
AAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAER
KTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECR
FGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSI
CMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIP
SVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKP
RKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H000	1.000	1.000	1.295E-80	416	1.000	1.000	Q9H000.pdb.gz	MKRN2_HUMAN E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens OX=9606 GN=MKRN2 PE=1 SV=2
2	AFDB:Q9ERV1	0.640	0.640	2.477E-71	416	0.885	0.885	Q9ERV1.pdb.gz	MKRN2_MOUSE E3 ubiquitin-protein ligase makorin-2 OS=Mus musculus OX=10090 GN=Mkrn2 PE=1 SV=2
3	AFDB:B0F0H3	0.536	0.544	2.229E-56	409	0.632	0.643	B0F0H3.pdb.gz	MKRN2_XENLA E3 ubiquitin-protein ligase makorin-2 OS=Xenopus laevis OX=8355 GN=mkrn2 PE=2 SV=2
4	AFDB:Q9UHC7	0.480	0.415	9.204E-45	482	0.454	0.392	Q9UHC7.pdb.gz	MKRN1_HUMAN E3 ubiquitin-protein ligase makorin-1 OS=Homo sapiens OX=9606 GN=MKRN1 PE=1 SV=3
5	AFDB:Q13064	0.440	0.364	2.563E-35	507	0.368	0.302	Q13064.pdb.gz	MKRN3_HUMAN Probable E3 ubiquitin-protein ligase makorin-3 OS=Homo sapiens OX=9606 GN=MKRN3 PE=1 SV=1
6	AFDB:Q9VP20	0.406	0.436	1.736E-30	386	0.325	0.350	Q9VP20.pdb.gz	Q9VP20_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Mkrn1 PE=2 SV=2
7	AFDB:Q9STM4	0.075	0.071	1.339E-5	448	0.144	0.134	Q9STM4.pdb.gz	C3H43_ARATH Zinc finger CCCH domain-containing protein 43 OS=Arabidopsis thaliana OX=3702 GN=At3g48440 PE=2 SV=1
8	AFDB:P41000	0.093	0.071	8.732E-5	583	0.111	0.079	P41000.pdb.gz	CPS3_SCHPO Protein cps3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cps3 PE=1 SV=3
9	AFDB:O74463	0.093	0.074	1.352E-4	547	0.094	0.071	O74463.pdb.gz	YQC1_SCHPO Uncharacterized protein C1739.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1739.01 PE=1 SV=2
10	AFDB:Q9SQU4	0.092	0.087	4.165E-4	462	0.195	0.175	Q9SQU4.pdb.gz	C3H34_ARATH Zinc finger CCCH domain-containing protein 34 OS=Arabidopsis thaliana OX=3702 GN=At3g06410 PE=2 SV=2
11	PDB:7dvqM	0.094	0.188	4.098E-2	191	0.065	0.141	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:8a3tU	0.129	0.405	7.655E-2	114	0.050	0.184	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
13	PDB:7egb0	0.149	0.244	3.430E-1	234	0.077	0.137	7egb0.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:7lbmd	0.149	0.213	4.990E-1	275	0.077	0.116	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
15	PDB:6ff4t	0.094	0.205	5.312E-1	172	0.065	0.157	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:7z36B	0.119	0.113	8.758E-1	446	0.082	0.076	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
17	PDB:5ds9B	0.061	0.148	1.197	98	0.022	0.092	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
18	PDB:6eojB	0.055	0.232	1.197	94	0.031	0.138	6eojB.pdb.gz	Architecture of eukaryotic mRNA 3'-end processing machinery.
19	PDB:6id0O	0.078	0.095	1.197	290	0.048	0.069	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:7abiP	0.065	0.109	1.197	237	0.024	0.042	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0F0H3	0.0	532	409	0.635	0.645	MKRN2_XENLA E3 ubiquitin-protein ligase makorin-2 OS=Xenopus laevis OX=8355 GN=mkrn2 PE=2 SV=2
2	Q9ERV1	0.0	765	416	0.885	0.885	MKRN2_MOUSE E3 ubiquitin-protein ligase makorin-2 OS=Mus musculus OX=10090 GN=Mkrn2 PE=1 SV=2
3	Q9H000	0.0	872	416	1.000	1.000	MKRN2_HUMAN E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens OX=9606 GN=MKRN2 PE=1 SV=2
4	Q9UHC7	1.55e-123	368	482	0.435	0.376	MKRN1_HUMAN E3 ubiquitin-protein ligase makorin-1 OS=Homo sapiens OX=9606 GN=MKRN1 PE=1 SV=3
5	Q9QXP6	6.84e-122	364	481	0.440	0.380	MKRN1_MOUSE E3 ubiquitin-protein ligase makorin-1 OS=Mus musculus OX=10090 GN=Mkrn1 PE=1 SV=1
6	Q13064	6.99e-84	267	507	0.344	0.282	MKRN3_HUMAN Probable E3 ubiquitin-protein ligase makorin-3 OS=Homo sapiens OX=9606 GN=MKRN3 PE=1 SV=1
7	Q9VP20	8.92e-73	234	386	0.298	0.321	Q9VP20_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Mkrn1 PE=2 SV=2
8	P41000	1.40e-11	68.6	583	0.060	0.043	CPS3_SCHPO Protein cps3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cps3 PE=1 SV=3
9	O74463	2.81e-08	58.2	547	0.062	0.048	YQC1_SCHPO Uncharacterized protein C1739.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1739.01 PE=1 SV=2
10	Q9JJ48	2.13e-07	54.7	305	0.058	0.079	ZC3H8_MOUSE Zinc finger CCCH domain-containing protein 8 OS=Mus musculus OX=10090 GN=Zc3h8 PE=1 SV=2
11	Q8N5P1	4.74e-07	53.5	291	0.058	0.082	ZC3H8_HUMAN Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZC3H8 PE=1 SV=2
12	Q6ZPZ3	1.62e-06	52.8	1304	0.050	0.016	ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zc3h4 PE=1 SV=2
13	Q9UPT8	1.77e-06	52.8	1303	0.050	0.016	ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3
14	Q8VZ73	2.28e-05	48.1	296	0.065	0.091	Q8VZ73_ARATH Putative RING zinc finger protein OS=Arabidopsis thaliana OX=3702 GN=At2g39100 PE=1 SV=1
15	Q9UTD1	2.99e-05	46.6	170	0.050	0.124	YTH1_SCHPO mRNA 3'-end-processing protein yth1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yth1 PE=3 SV=1
16	Q22805	2.88e-04	45.4	574	0.043	0.031	Q22805_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T26A8.4 PE=1 SV=1
17	Q8IXZ2	5.52e-04	44.7	948	0.048	0.021	ZC3H3_HUMAN Zinc finger CCCH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZC3H3 PE=1 SV=3
18	Q8CHP0	8.73e-04	44.3	950	0.048	0.021	ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zc3h3 PE=1 SV=1
19	Q54MG5	0.001	43.5	437	0.062	0.059	Q54MG5_DICDI C3H1-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285973 PE=4 SV=2
20	Q7YXD9	0.001	43.1	419	0.053	0.053	Q7YXD9_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18769 APOBEC1	2.8e+02	13.1	APOBEC1
2	PF15815 MKRN1_C	2e+02	13.5	E3 ubiquitin-protein ligase makorin, C-terminal
3	PF16131 Torus	4.3e-12	58.1	Torus domain
4	PF00097 zf-C3HC4	0.19	22.9	Zinc finger, C3HC4 type (RING finger)
5	PF15227 zf-C3HC4_4	21	16.6	zinc finger of C3HC4-type, RING
6	PF00642 zf-CCCH	3.4e-17	73.2	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
7	PF14608 zf-CCCH_2	1.1e-11	56.1	RNA-binding, Nab2-type zinc finger
8	PF15663 zf-CCCH_3	0.23	23.0	Zinc-finger containing family
9	PF18044 zf-CCCH_4	1.1e-19	81.0	CCCH-type zinc finger
10	PF13639 zf-RING_2	0.91	21.2	Ring finger domain
11	PF14634 zf-RING_5	3.9	18.8	zinc-RING finger domain
12	PF13445 zf-RING_UBOX	0.18	23.2	RING-type zinc-finger
13	PF18345 zf_CCCH_4	1.9e-18	77.1	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000170447

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302768	0.820	Polyadenylate-binding protein-interacting protein 1
2	9606.ENSP00000308622	0.686	Nucleoporin GLE1
3	9606.ENSP00000284995	0.674	tRNA-splicing endonuclease subunit Sen2
4	9606.ENSP00000310928	0.674	Peroxisome proliferator-activated receptor delta
5	9606.ENSP00000324806	0.650	Glycogen synthase kinase-3 beta
6	9606.ENSP00000432845	0.628	RNA-binding protein MEX3A
7	9606.ENSP00000339795	0.625	60S ribosomal protein L7
8	9606.ENSP00000312618	0.608	Acyl-CoA dehydrogenase family member 9, mitochondrial
9	9606.ENSP00000362774	0.606	Roquin-2
10	9606.ENSP00000312634	0.590	PDZ and LIM domain protein 2
11	9606.ENSP00000263549	0.576	poly(ADP-ribose) polymerase family member 12
12	9606.ENSP00000258742	0.573	Nucleoporin-like protein 2
13	9606.ENSP00000222330	0.544	Glycogen synthase kinase-3 alpha
14	9606.ENSP00000356669	0.539	Roquin-1
15	9606.ENSP00000470087	0.535	Uncharacterized protein
16	9606.ENSP00000426909	0.521	Receptor of activated protein C kinase 1
17	9606.ENSP00000379773	0.500	Zinc finger CCCH domain-containing protein 7A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0019787	0.977	ubiquitin-like protein transferase activity
GO:0004842	0.969	ubiquitin-protein transferase activity
GO:0061659	0.930	ubiquitin-like protein ligase activity
GO:0061630	0.894	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0050794	0.995	regulation of cellular process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0019538	0.983	protein metabolic process
GO:0023051	0.974	regulation of signaling
GO:0010646	0.974	regulation of cell communication
GO:0048583	0.948	regulation of response to stimulus
GO:0048519	0.929	negative regulation of biological process
GO:0009966	0.919	regulation of signal transduction
GO:1901575	0.915	organic substance catabolic process
GO:0048523	0.886	negative regulation of cellular process
GO:0006508	0.857	proteolysis
GO:0044260	0.842	cellular macromolecule metabolic process
GO:1901565	0.835	organonitrogen compound catabolic process
GO:0002682	0.770	regulation of immune system process
GO:0009057	0.770	macromolecule catabolic process
GO:0044248	0.764	cellular catabolic process
GO:0080134	0.717	regulation of response to stress
GO:0044265	0.704	cellular macromolecule catabolic process
GO:0030163	0.681	protein catabolic process
GO:0048585	0.676	negative regulation of response to stimulus
GO:0051603	0.617	proteolysis involved in protein catabolic process
GO:0031347	0.575	regulation of defense response
GO:0032101	0.490	regulation of response to external stimulus
GO:0019222	0.474	regulation of metabolic process
GO:0060255	0.460	regulation of macromolecule metabolic process
GO:0048518	0.448	positive regulation of biological process
GO:0048522	0.411	positive regulation of cellular process
GO:0006511	0.406	ubiquitin-dependent protein catabolic process
GO:0031323	0.345	regulation of cellular metabolic process
GO:0051171	0.341	regulation of nitrogen compound metabolic process
GO:0034641	0.328	cellular nitrogen compound metabolic process
GO:1901360	0.323	organic cyclic compound metabolic process
GO:0050776	0.316	regulation of immune response
GO:0010468	0.312	regulation of gene expression
GO:0010467	0.308	gene expression
GO:0050896	0.302	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.946	cytosol
GO:0032991	0.797	protein-containing complex
GO:0031981	0.398	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.977	Transferases.

[back to server]