StarFunc result for job id Q9H009

User Input

>input (215 residues)
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEID
EEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD
VKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8JIU7	0.734	0.734	1.601E-30	215	0.870	0.870	Q8JIU7.pdb.gz	NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio OX=7955 GN=naca PE=1 SV=1
2	AFDB:P70670	0.409	0.059	1.537E-27	2187	0.823	0.081	P70670.pdb.gz	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
3	AFDB:O15069	0.378	0.075	6.047E-22	1562	0.605	0.083	O15069.pdb.gz	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
4	AFDB:Q94518	0.548	0.544	2.446E-21	217	0.558	0.553	Q94518.pdb.gz	NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=Nacalpha PE=1 SV=2
5	AFDB:Q94JX9	0.385	0.382	9.437E-19	217	0.451	0.447	Q94JX9.pdb.gz	NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
6	AFDB:Q6ICZ8	0.371	0.390	1.444E-18	204	0.428	0.451	Q6ICZ8.pdb.gz	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
7	AFDB:Q9LHG9	0.369	0.390	1.957E-18	203	0.437	0.463	Q9LHG9.pdb.gz	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
8	AFDB:Q8LGC6	0.337	0.346	3.381E-18	209	0.386	0.397	Q8LGC6.pdb.gz	NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g33040 PE=2 SV=2
9	AFDB:Q9SZY1	0.338	0.342	1.140E-17	212	0.405	0.410	Q9SZY1.pdb.gz	NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
10	AFDB:Q86S66	0.336	0.370	1.211E-17	195	0.451	0.497	Q86S66.pdb.gz	NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans OX=6239 GN=icd-2 PE=1 SV=2
11	PDB:7qwrt	0.295	0.890	1.374E-8	67	0.279	0.896	7qwrt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
12	PDB:7qwqt	0.208	0.849	1.048E-3	47	0.205	0.936	7qwqt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
13	PDB:6c95D	0.188	0.406	8.329E-2	95	0.093	0.211	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
14	PDB:7av6A	0.115	0.207	1.275E-1	99	0.056	0.121	7av6A.pdb.gz
15	PDB:7nvrl	0.079	0.042	3.370E-1	501	0.065	0.028	7nvrl.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
16	PDB:4gwqG	0.136	0.134	4.852E-1	170	0.065	0.082	4gwqG.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
17	PDB:5j0nF	0.093	0.060	4.852E-1	356	0.047	0.028	5j0nF.pdb.gz	Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
18	PDB:6j6qF	0.098	0.124	5.823E-1	161	0.112	0.149	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
19	PDB:7r04A	0.087	0.023	7.425E-1	2326	0.065	0.006	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
20	PDB:4xb6C	0.160	0.098	7.890E-1	353	0.065	0.040	4xb6C.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13765	1.18e-119	340	215	0.902	0.902	NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1
2	Q60817	1.18e-119	340	215	0.902	0.902	NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus OX=10090 GN=Naca PE=1 SV=1
3	Q8JIU7	1.90e-114	327	215	0.870	0.870	NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio OX=7955 GN=naca PE=1 SV=1
4	P70670	2.17e-98	315	2187	0.800	0.079	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
5	O15069	3.31e-66	223	1562	0.567	0.078	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
6	Q94518	5.12e-58	184	217	0.516	0.512	NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=Nacalpha PE=1 SV=2
7	Q86S66	3.61e-50	163	195	0.419	0.462	NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans OX=6239 GN=icd-2 PE=1 SV=2
8	Q94JX9	1.06e-49	163	217	0.414	0.410	NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
9	Q9LHG9	1.26e-47	157	203	0.423	0.448	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
10	Q9SZY1	2.68e-46	154	212	0.405	0.410	NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
11	Q6ICZ8	3.07e-44	148	204	0.409	0.431	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
12	Q8LGC6	2.23e-43	146	209	0.381	0.392	NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g33040 PE=2 SV=2
13	P87147	6.54e-33	118	173	0.344	0.428	NACA_SCHPO Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=egd2 PE=1 SV=1
14	Q9VPV7	6.38e-29	112	347	0.386	0.239	Q9VPV7_DROME GH09281p OS=Drosophila melanogaster OX=7227 GN=gNacalpha PE=2 SV=2
15	Q38EE8	5.96e-25	98.6	188	0.284	0.324	Q38EE8_TRYB2 Nascent polypeptide associated complex subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0120 PE=4 SV=1
16	Q6FJD5	1.07e-23	94.7	165	0.265	0.345	NACA_CANGA Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EGD2 PE=3 SV=1
17	Q5ANP2	1.30e-21	89.7	178	0.256	0.309	NACA_CANAL Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EGD2 PE=3 SV=1
18	P38879	5.72e-17	77.4	174	0.251	0.310	NACA_YEAST Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGD2 PE=1 SV=3
19	Q9CR41	0.053	35.0	121	0.070	0.124	HYPK_MOUSE Huntingtin-interacting protein K OS=Mus musculus OX=10090 GN=Hypk PE=1 SV=3
20	Q9NX55	0.053	35.0	121	0.070	0.124	HYPK_HUMAN Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19026 HYPK_UBA	3.1e-07	41.0	HYPK UBA domain
2	PF01849 NAC	2.3e-13	61.3	NAC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427802

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360664	0.981	Basic transcription factor 3 like 4
2	9606.ENSP00000369965	0.950	Transcription factor BTF3
3	9606.ENSP00000259469	0.846	60S ribosomal protein L35
4	9606.ENSP00000311430	0.827	L ribosomal proteins
5	9606.ENSP00000375730	0.824	60S ribosomal protein L13a
6	9606.ENSP00000339795	0.823	60S ribosomal protein L7
7	9606.ENSP00000354739	0.816	60S ribosomal protein L12
8	9606.ENSP00000377640	0.806	Ribosomal protein L24
9	9606.ENSP00000221801	0.772	rRNA 2'-O-methyltransferase fibrillarin
10	9606.ENSP00000278572	0.772	40S ribosomal protein S3
11	9606.ENSP00000386541	0.772	26S proteasome non-ATPase regulatory subunit 14
12	9606.ENSP00000448035	0.770	Nascent polypeptide-associated complex subunit alpha, muscle-specific form
13	9606.ENSP00000482075	0.762	Prostaglandin E synthase 3
14	9606.ENSP00000225430	0.749	Ribosomal protein L19
15	9606.ENSP00000416429	0.736	Ribosomal protein L32
16	9606.ENSP00000351777	0.735	Transitional endoplasmic reticulum ATPase
17	9606.ENSP00000361626	0.734	Nuclease-sensitive element-binding protein 1
18	9606.ENSP00000401802	0.729	26S proteasome regulatory subunit 10B
19	9606.ENSP00000261712	0.726	26S proteasome non-ATPase regulatory subunit 11
20	9606.ENSP00000348442	0.726	26S proteasome non-ATPase regulatory subunit 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0008152	0.807	metabolic process
GO:0071704	0.801	organic substance metabolic process
GO:0044237	0.773	cellular metabolic process
GO:0044238	0.768	primary metabolic process
GO:0006807	0.748	nitrogen compound metabolic process
GO:0043170	0.747	macromolecule metabolic process
GO:1901564	0.718	organonitrogen compound metabolic process
GO:0019538	0.710	protein metabolic process
GO:0034641	0.655	cellular nitrogen compound metabolic process
GO:0044260	0.647	cellular macromolecule metabolic process
GO:1901576	0.625	organic substance biosynthetic process
GO:0044271	0.625	cellular nitrogen compound biosynthetic process
GO:0010467	0.621	gene expression
GO:0009059	0.621	macromolecule biosynthetic process
GO:0065007	0.596	biological regulation
GO:0050789	0.589	regulation of biological process
GO:0050794	0.515	regulation of cellular process
GO:0006518	0.515	peptide metabolic process
GO:0006412	0.512	translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0005634	0.979	nucleus
GO:0043232	0.947	intracellular non-membrane-bounded organelle
GO:0032991	0.935	protein-containing complex
GO:0005829	0.895	cytosol
GO:0070013	0.514	intracellular organelle lumen
GO:0031981	0.496	nuclear lumen
GO:0016020	0.482	membrane
GO:0070062	0.368	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]