StarFunc result for job id Q9H074

User Input

>input (479 residues)
MSDGFDRAPGAGRGRSRGLGRGGGGPEGGGFPNGAGPAERARHQPPQPKAPGFLQPPPLR
QPRTTPPPGAQCEVPASPQRPSRPGALPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVV
APVLMSKLSVNAPEFYPSGYSSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQPGSFETEI
EQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQ
LLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGL
RELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSR
DVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQ
EKYQELLEREDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H074	1.000	1.000	6.991E-64	479	1.000	1.000	Q9H074.pdb.gz	PAIP1_HUMAN Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1 PE=1 SV=1
2	AFDB:A1Z968	0.367	0.126	1.654E-8	1488	0.169	0.054	A1Z968.pdb.gz	A1Z968_DROME NAT1, isoform D OS=Drosophila melanogaster OX=7227 GN=NAT1 PE=1 SV=1
3	PDB:4jhjA	0.352	0.745	3.941E-7	216	0.086	0.190	4jhjA.pdb.gz	Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
4	AFDB:D3DQV9	0.376	0.211	6.104E-6	907	0.152	0.080	D3DQV9.pdb.gz	D3DQV9_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
5	PDB:7dvqV	0.336	0.343	8.282E-5	468	0.094	0.096	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
6	PDB:5mqfT	0.325	0.389	5.408E-4	395	0.086	0.104	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
7	AFDB:Q84JR9	0.114	0.094	6.971E-4	682	0.132	0.092	Q84JR9.pdb.gz	TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana OX=3702 GN=TTL4 PE=2 SV=1
8	AFDB:Q584T3	0.150	0.110	1.063E-3	775	0.102	0.063	Q584T3.pdb.gz	Q584T3_TRYB2 Mitochondrial oligo U binding protein TBRGG1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.600 PE=4 SV=1
9	PDB:5gm6Z	0.199	0.211	1.196E-2	447	0.065	0.069	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
10	PDB:7kzqE	0.129	0.143	1.741E-2	419	0.088	0.100	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
11	AFDB:P24639	0.137	0.141	1.949E-2	462	0.148	0.154	P24639.pdb.gz	ANXA7_DICDI Annexin A7 OS=Dictyostelium discoideum OX=44689 GN=nxnA PE=1 SV=1
12	AFDB:A0A0P0X9Z7	0.098	0.045	2.351E-2	1600	0.125	0.037	A0A0P0X9Z7.pdb.gz	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
13	AFDB:Q9MAH1	0.107	0.086	2.464E-2	699	0.132	0.090	Q9MAH1.pdb.gz	TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana OX=3702 GN=TTL1 PE=1 SV=1
14	AFDB:Q9U479	0.086	0.069	2.464E-2	638	0.169	0.127	Q9U479.pdb.gz	Q9U479_DROME Short stop/Kakapo isoform C (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=2
15	AFDB:Q09829	0.116	0.085	2.582E-2	780	0.113	0.069	Q09829.pdb.gz	YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.03c PE=4 SV=1
16	PDB:3feyA	0.332	0.219	3.056E-2	761	0.077	0.049	3feyA.pdb.gz
17	PDB:1b3uA	0.185	0.155	3.687E-2	588	0.065	0.053	1b3uA.pdb.gz
18	PDB:7wttK	0.161	0.094	5.624E-2	1022	0.086	0.040	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
19	PDB:4tnmA	0.206	0.235	6.473E-2	407	0.073	0.086	4tnmA.pdb.gz
20	PDB:6l4oA	0.184	0.203	6.473E-2	429	0.075	0.084	6l4oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7ZYB4	0.0	583	463	0.672	0.695	PAIP1_XENLA Polyadenylate-binding protein-interacting protein 1 OS=Xenopus laevis OX=8355 GN=paip1 PE=1 SV=1
2	Q8VE62	0.0	795	400	0.802	0.960	PAIP1_MOUSE Polyadenylate-binding protein-interacting protein 1 OS=Mus musculus OX=10090 GN=Paip1 PE=1 SV=1
3	Q9H074	0.0	988	479	1.000	1.000	PAIP1_HUMAN Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1 PE=1 SV=1
4	Q4LE58	3.66e-17	87.4	1624	0.161	0.047	Q4LE58_HUMAN eIF4G1 variant protein (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 variant protein PE=2 SV=1
5	B2RU06	3.68e-17	87.0	1606	0.161	0.048	B2RU06_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
6	B2RU10	3.71e-17	87.0	1606	0.161	0.048	B2RU10_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
7	E7EUU4	3.99e-17	87.0	1560	0.161	0.049	E7EUU4_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
8	Q04637	4.16e-17	87.0	1599	0.161	0.048	IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4
9	B4DGF1	4.21e-17	87.0	1566	0.161	0.049	B4DGF1_HUMAN cDNA FLJ56479, highly similar to Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 PE=2 SV=1
10	E9PGM1	4.44e-17	87.0	1513	0.161	0.051	E9PGM1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
11	E7EX73	4.50e-17	87.0	1436	0.161	0.054	E7EX73_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
12	B4DSI9	1.24e-16	85.5	1512	0.159	0.050	B4DSI9_HUMAN cDNA FLJ56483, highly similar to Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q6NZJ6	2.35e-15	81.6	1600	0.154	0.046	IF4G1_MOUSE Eukaryotic translation initiation factor 4 gamma 1 OS=Mus musculus OX=10090 GN=Eif4g1 PE=1 SV=1
14	D3ZU13	2.46e-15	81.6	1598	0.154	0.046	D3ZU13_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=1
15	M0RD03	2.54e-15	81.3	1641	0.154	0.045	M0RD03_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=2
16	D4AD15	2.77e-15	81.3	1634	0.154	0.045	D4AD15_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=3
17	O43310	1.25e-14	78.6	598	0.111	0.089	CTIF_HUMAN CBP80/20-dependent translation initiation factor OS=Homo sapiens OX=9606 GN=CTIF PE=1 SV=1
18	Q80XI3	8.87e-13	73.6	1579	0.136	0.041	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
19	O43432	4.22e-12	71.2	1585	0.136	0.041	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
20	C9JF13	2.98e-11	68.2	903	0.148	0.079	C9JF13_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	3.4e+02	13.3	Apoptosis regulator proteins, Bcl-2 family
2	PF02854 MIF4G	4.5e-36	136.0	MIF4G domain
3	PF07145 PAM2	0.086	23.6	Ataxin-2 C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313007	0.999	Polyadenylate-binding protein 1
2	9606.ENSP00000293831	0.980	Eukaryotic initiation factor 4A-I
3	9606.ENSP00000425561	0.966	Eukaryotic translation initiation factor 4E
4	9606.ENSP00000326381	0.964	Eukaryotic initiation factor 4A-II
5	9606.ENSP00000320949	0.959	CCR4-NOT transcription complex subunit 1
6	9606.ENSP00000388806	0.956	Eukaryotic translation initiation factor 4B
7	9606.ENSP00000255136	0.952	Polyadenylate-binding protein 1-like
8	9606.ENSP00000378275	0.951	Polyadenylate-binding protein-interacting protein 2
9	9606.ENSP00000387911	0.941	Poly(A)-specific ribonuclease PARN
10	9606.ENSP00000351159	0.937	CCR4-NOT transcription complex subunit 3
11	9606.ENSP00000361949	0.937	Polyadenylate-binding protein 4
12	9606.ENSP00000253108	0.930	Eukaryotic translation initiation factor 3 subunit G
13	9606.ENSP00000281589	0.930	Polyadenylate-binding protein 3
14	9606.ENSP00000313199	0.930	Heterogeneous nuclear ribonucleoprotein D0
15	9606.ENSP00000355279	0.927	CCR4-NOT transcription complex subunit 7
16	9606.ENSP00000399862	0.923	CCR4-NOT transcription complex subunit 10
17	9606.ENSP00000229195	0.917	CCR4-NOT transcription complex subunit 2
18	9606.ENSP00000273064	0.917	CCR4-NOT transcription complex subunit 9
19	9606.ENSP00000445508	0.917	CCR4-NOT transcription complex subunit 4
20	9606.ENSP00000308012	0.915	Polyadenylate-binding protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.999	RNA binding
GO:0008494	0.995	translation activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:0051172	0.983	negative regulation of nitrogen compound metabolic process
GO:0010605	0.983	negative regulation of macromolecule metabolic process
GO:0031324	0.982	negative regulation of cellular metabolic process
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0061013	0.980	regulation of mRNA catabolic process
GO:0006417	0.979	regulation of translation
GO:0006412	0.975	translation
GO:0051173	0.974	positive regulation of nitrogen compound metabolic process
GO:1902369	0.974	negative regulation of RNA catabolic process
GO:0031325	0.971	positive regulation of cellular metabolic process
GO:0006413	0.971	translational initiation
GO:0010628	0.966	positive regulation of gene expression
GO:0043487	0.959	regulation of RNA stability
GO:0043488	0.950	regulation of mRNA stability
GO:1903312	0.936	negative regulation of mRNA metabolic process
GO:1902373	0.933	negative regulation of mRNA catabolic process
GO:0043489	0.930	RNA stabilization
GO:0044403	0.919	biological process involved in symbiotic interaction
GO:0034250	0.914	positive regulation of amide metabolic process
GO:0051247	0.908	positive regulation of protein metabolic process
GO:0048255	0.906	mRNA stabilization
GO:2000765	0.871	regulation of cytoplasmic translation
GO:0045727	0.871	positive regulation of translation
GO:0051702	0.806	biological process involved in interaction with symbiont
GO:0051851	0.801	modulation by host of symbiont process
GO:0044788	0.433	modulation by host of viral process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0043226	0.938	organelle
GO:0043229	0.934	intracellular organelle
GO:0043227	0.817	membrane-bounded organelle
GO:0043231	0.807	intracellular membrane-bounded organelle
GO:0106002	0.693	mCRD-mediated mRNA stability complex
GO:0005634	0.405	nucleus
GO:0012505	0.337	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]