StarFunc result for job id Q9H078

User Input

>input (707 residues)
MLGSLVLRRKALAPRLLLRLLRSPTLRGHGGASGRNVTTGSLGEPQWLRVATGGRPGTSP
ALFSGRGAATGGRQGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAA
ALVVHCYSKSPSNKDAALLEAARANNMQEVSRLLSEGADVNAKHRLGWTALMVAAINRNN
SVVQVLLAAGADPNLGDDFSSVYKTAKEQGIHSLEDGGQDGASRHITNQWTSALEFRRWL
GLPAGVLITREDDFNNRLNNRASFKGCTALHYAVLADDYRTVKELLDGGANPLQRNEMGH
TPLDYAREGEVMKLLRTSEAKYQEKQRKREAEERRRFPLEQRLKEHIIGQESAIATVGAA
IRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEV
AKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGK
GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNF
KENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLL
WDREVADVLVDGYNVHYGARSIKHEVERRVVNQLAAAYEQDLLPGGCTLRITVEDSDKQL
LKSPELPSPQAEKRLPKLRLEIIDKDSKTRRLDIRAPLHPEKVCNTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H078	1.000	1.000	0.000	707	1.000	1.000	Q9H078.pdb.gz	CLPB_HUMAN Mitochondrial disaggregase OS=Homo sapiens OX=9606 GN=CLPB PE=1 SV=1
2	AFDB:Q60649	0.765	0.798	2.258E-102	677	0.842	0.879	Q60649.pdb.gz	CLPB_MOUSE Mitochondrial disaggregase OS=Mus musculus OX=10090 GN=Clpb PE=1 SV=1
3	AFDB:Q2G0P5	0.389	0.338	5.499E-28	818	0.185	0.160	Q2G0P5.pdb.gz	CLPC_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=clpC PE=1 SV=1
4	AFDB:P9WPC9	0.401	0.338	5.794E-28	848	0.177	0.147	P9WPC9.pdb.gz	CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpC1 PE=1 SV=1
5	AFDB:Q6F2Y7	0.399	0.316	9.270E-28	912	0.198	0.154	Q6F2Y7.pdb.gz	CLPB1_ORYSJ Chaperone protein ClpB1 OS=Oryza sativa subsp. japonica OX=39947 GN=CLPB1 PE=2 SV=1
6	AFDB:Q1D2Y0	0.397	0.320	1.029E-27	884	0.181	0.145	Q1D2Y0.pdb.gz	Q1D2Y0_MYXXD ATP-dependent Clp protease, ATP-binding subunit ClpC OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=clpC PE=3 SV=1
7	AFDB:Q9LF37	0.389	0.289	1.336E-27	968	0.188	0.137	Q9LF37.pdb.gz	CLPB3_ARATH Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPB3 PE=1 SV=1
8	AFDB:Q8VYJ7	0.403	0.303	3.420E-27	964	0.187	0.137	Q8VYJ7.pdb.gz	CLPB4_ARATH Chaperone protein ClpB4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPB4 PE=2 SV=1
9	AFDB:P37571	0.384	0.337	3.797E-27	810	0.171	0.149	P37571.pdb.gz	CLPC_BACSU Negative regulator of genetic competence ClpC/MecB OS=Bacillus subtilis (strain 168) OX=224308 GN=clpC PE=1 SV=1
10	AFDB:Q75GT3	0.415	0.309	6.743E-27	978	0.205	0.148	Q75GT3.pdb.gz	CLPB2_ORYSJ Chaperone protein ClpB2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CLPB2 PE=2 SV=1
11	PDB:4d2qA	0.379	0.343	1.135E-24	789	0.190	0.170	4d2qA.pdb.gz
12	PDB:8a8wD	0.395	0.478	3.580E-24	577	0.168	0.206	8a8wD.pdb.gz	Structure of the drug target ClpC1 unfoldase in action provides insights on antibiotic mechanism of action.
13	PDB:6qs6B	0.382	0.459	7.058E-24	582	0.185	0.225	6qs6B.pdb.gz	Two-Step Activation Mechanism of the ClpB Disaggregase for Sequential Substrate Threading by the Main ATPase Motor.
14	PDB:6qs6C	0.385	0.430	1.254E-23	630	0.205	0.230	6qs6C.pdb.gz	Two-Step Activation Mechanism of the ClpB Disaggregase for Sequential Substrate Threading by the Main ATPase Motor.
15	PDB:7abrD	0.386	0.461	3.753E-23	586	0.154	0.186	7abrD.pdb.gz	BacPROTACs mediate targeted protein degradation in bacteria.
16	PDB:7l6nC	0.377	0.394	2.103E-22	675	0.209	0.219	7l6nC.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
17	PDB:6w6iF	0.366	0.426	3.735E-22	605	0.184	0.215	6w6iF.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
18	PDB:6w6hC	0.368	0.407	1.118E-21	636	0.192	0.214	6w6hC.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
19	PDB:1qvrA	0.353	0.315	2.093E-21	803	0.197	0.173	1qvrA.pdb.gz	The Structure of ClpB: A Molecular Chaperone that Rescues Proteins from an Aggregated State
20	PDB:6w6jD	0.364	0.364	2.447E-21	707	0.178	0.178	6w6jD.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q60649	0.0	1188	677	0.846	0.883	CLPB_MOUSE Mitochondrial disaggregase OS=Mus musculus OX=10090 GN=Clpb PE=1 SV=1
2	Q9H078	0.0	1457	707	1.000	1.000	CLPB_HUMAN Mitochondrial disaggregase OS=Homo sapiens OX=9606 GN=CLPB PE=1 SV=1
3	P63284	4.83e-61	222	857	0.184	0.152	CLPB_ECOLI Chaperone protein ClpB OS=Escherichia coli (strain K12) OX=83333 GN=clpB PE=1 SV=1
4	Q2G0P5	7.62e-59	215	818	0.168	0.145	CLPC_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=clpC PE=1 SV=1
5	Q8VYJ7	4.85e-58	214	964	0.164	0.120	CLPB4_ARATH Chaperone protein ClpB4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPB4 PE=2 SV=1
6	Q9FI56	1.16e-56	210	929	0.170	0.129	CLPC1_ARATH Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPC1 PE=1 SV=1
7	Q1D2Y0	1.98e-56	209	884	0.175	0.140	Q1D2Y0_MYXXD ATP-dependent Clp protease, ATP-binding subunit ClpC OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=clpC PE=3 SV=1
8	Q9RA63	1.04e-55	206	854	0.168	0.139	CLPB_THET8 Chaperone protein ClpB OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=clpB PE=1 SV=2
9	P42730	8.74e-55	204	911	0.168	0.131	CLPB1_ARATH Chaperone protein ClpB1 OS=Arabidopsis thaliana OX=3702 GN=CLPB1 PE=1 SV=2
10	Q9LF37	1.15e-54	204	968	0.178	0.130	CLPB3_ARATH Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPB3 PE=1 SV=1
11	P33416	1.28e-54	203	811	0.170	0.148	HSP78_YEAST Heat shock protein 78, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP78 PE=1 SV=2
12	Q9SXJ7	2.16e-54	203	952	0.164	0.122	CLPC2_ARATH Chaperone protein ClpC2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPC2 PE=1 SV=1
13	P9WPD1	4.03e-54	202	848	0.167	0.139	CLPB_MYCTU Chaperone protein ClpB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpB PE=1 SV=1
14	O94641	4.87e-54	202	905	0.168	0.131	HS104_SCHPO Heat shock protein 104 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp104 PE=3 SV=1
15	Q54EV3	1.22e-53	201	886	0.161	0.129	Q54EV3_DICDI AAA ATPase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291314 PE=3 SV=1
16	Q6F2Y7	2.57e-53	200	912	0.167	0.129	CLPB1_ORYSJ Chaperone protein ClpB1 OS=Oryza sativa subsp. japonica OX=39947 GN=CLPB1 PE=2 SV=1
17	Q0E3C8	6.95e-53	199	983	0.163	0.117	CLPB3_ORYSJ Chaperone protein ClpB3, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=CLPB3 PE=2 SV=3
18	P37571	7.07e-53	197	810	0.167	0.146	CLPC_BACSU Negative regulator of genetic competence ClpC/MecB OS=Bacillus subtilis (strain 168) OX=224308 GN=clpC PE=1 SV=1
19	P9WPC9	7.43e-53	198	848	0.158	0.132	CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpC1 PE=1 SV=1
20	P42762	1.17e-50	192	945	0.165	0.124	CLPD_ARATH Chaperone protein ClpD, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	8e-05	34.5	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	15	17.4	AAA ATPase domain
3	PF07724 AAA_2	3.7e-42	155.9	AAA domain (Cdc48 subfamily)
4	PF13401 AAA_22	71	15.1	AAA domain
5	PF13479 AAA_24	45	15.2	AAA domain
6	PF07726 AAA_3	65	14.8	ATPase family associated with various cellular activities (AAA)
7	PF13671 AAA_33	47	15.6	AAA domain
8	PF07728 AAA_5	1.8e-05	36.2	AAA domain (dynein-related subfamily)
9	PF00005 ABC_tran	3.6e+02	13.1	ABC transporter
10	PF00023 Ank	1.4e-13	61.8	Ankyrin repeat
11	PF12796 Ank_2	4e-15	67.5	Ankyrin repeats (3 copies)
12	PF13606 Ank_3	1.7e-10	51.0	Ankyrin repeat
13	PF13637 Ank_4	5.3e-07	41.3	Ankyrin repeats (many copies)
14	PF13857 Ank_5	1e-13	62.5	Ankyrin repeats (many copies)
15	PF01637 ATPase_2	4e+02	12.3	ATPase domain predominantly from Archaea
16	PF10431 ClpB_D2-small	2.2e-06	38.9	C-terminal, D2-small domain, of ClpB protein
17	PF17542 RP853	4.5e+02	11.3	Uncharacterized RP853
18	PF00158 Sigma54_activat	0.032	25.4	Sigma-54 interaction domain
19	PF06309 Torsin	19	16.8	Torsin
20	PF06071 YchF-GTPase_C	1.5e+02	14.0	Protein of unknown function (DUF933)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245816	0.996	ATP-dependent Clp protease proteolytic subunit, mitochondrial
2	9606.ENSP00000302961	0.995	Heat shock protein family A member 4
3	9606.ENSP00000264954	0.986	GrpE protein homolog 1, mitochondrial
4	9606.ENSP00000373620	0.958	60 kDa heat shock protein, mitochondrial
5	9606.ENSP00000300107	0.954	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
6	9606.ENSP00000233893	0.947	10 kDa heat shock protein, mitochondrial
7	9606.ENSP00000351646	0.928	Stress-induced-phosphoprotein 1
8	9606.ENSP00000254322	0.922	DnaJ homolog subfamily B member 1
9	9606.ENSP00000343023	0.899	Nuclear autoantigen Sp-100
10	9606.ENSP00000335153	0.881	Heat shock protein HSP 90-alpha
11	9606.ENSP00000297185	0.860	Stress-70 protein, mitochondrial
12	9606.ENSP00000362390	0.839	T-box transcription factor TBX22
13	9606.ENSP00000262375	0.830	DnaJ homolog subfamily A member 3, mitochondrial
14	9606.ENSP00000398131	0.801	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
15	9606.ENSP00000318480	0.798	ATP-dependent zinc metalloprotease YME1L1
16	9606.ENSP00000255631	0.787	Hsp70-binding protein 1
17	9606.ENSP00000341247	0.787	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
18	9606.ENSP00000357980	0.772	Serine protease HTRA1
19	9606.ENSP00000359799	0.764	DnaJ homolog subfamily B member 4
20	9606.ENSP00000369127	0.757	DnaJ homolog subfamily A member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016887	1.000	ATP hydrolysis activity
GO:0140776	0.999	protein-containing complex destabilizing activity
GO:0042802	0.769	identical protein binding
GO:0140545	0.680	ATP-dependent protein disaggregase activity
GO:1901363	0.411	heterocyclic compound binding
GO:0097159	0.399	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.992	biological regulation
GO:0050789	0.972	regulation of biological process
GO:0050794	0.957	regulation of cellular process
GO:0050896	0.924	response to stimulus
GO:0006950	0.865	response to stress
GO:0048518	0.847	positive regulation of biological process
GO:0051716	0.812	cellular response to stimulus
GO:0002376	0.676	immune system process
GO:0048583	0.669	regulation of response to stimulus
GO:0009605	0.632	response to external stimulus
GO:0009615	0.609	response to virus
GO:0002682	0.604	regulation of immune system process
GO:0008152	0.566	metabolic process
GO:0006952	0.485	defense response
GO:0006955	0.479	immune response
GO:0071704	0.430	organic substance metabolic process
GO:0060255	0.397	regulation of macromolecule metabolic process
GO:0080090	0.390	regulation of primary metabolic process
GO:0044237	0.372	cellular metabolic process
GO:0032502	0.364	developmental process
GO:0044238	0.358	primary metabolic process
GO:0006807	0.349	nitrogen compound metabolic process
GO:0048856	0.347	anatomical structure development
GO:0080134	0.334	regulation of response to stress
GO:0007154	0.330	cell communication
GO:0048584	0.315	positive regulation of response to stimulus
GO:0007165	0.311	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005829	0.885	cytosol
GO:0031967	0.673	organelle envelope
GO:0005740	0.398	mitochondrial envelope
GO:0016020	0.342	membrane
GO:0005758	0.307	mitochondrial intermembrane space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	1.000	ATP + H2O = ADP + H(+) + phosphate

[back to server]