StarFunc result for job id Q9H081

User Input

>input (205 residues)
MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQI
RKCTEKFLCFMKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKE
IEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVS
LVQNSRKLQNIRDNVEKESKRLKIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H081	1.000	1.000	7.264E-30	205	1.000	1.000	Q9H081.pdb.gz	MIS12_HUMAN Protein MIS12 homolog OS=Homo sapiens OX=9606 GN=MIS12 PE=1 SV=1
2	PDB:5lsjA	0.497	0.511	5.587E-24	199	0.966	0.995	5lsjA.pdb.gz	Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores.
3	AFDB:Q59YF9	0.436	0.294	9.647E-5	314	0.195	0.127	Q59YF9.pdb.gz	Q59YF9_CANAL MIND complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MTW1 PE=3 SV=1
4	AFDB:Q2V0Z5	0.431	0.375	2.448E-4	238	0.141	0.122	Q2V0Z5.pdb.gz	MIS12_ARATH Protein MIS12 homolog OS=Arabidopsis thaliana OX=3702 GN=MIS12 PE=3 SV=1
5	AFDB:P39731	0.445	0.323	3.338E-4	289	0.210	0.149	P39731.pdb.gz	MTW1_YEAST Kinetochore-associated protein MTW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTW1 PE=1 SV=2
6	AFDB:Q9VS01	0.426	0.472	3.780E-4	181	0.127	0.144	Q9VS01.pdb.gz	Q9VS01_DROME Mis12 OS=Drosophila melanogaster OX=7227 GN=Mis12 PE=1 SV=1
7	AFDB:Q9Y738	0.382	0.309	3.531E-3	259	0.117	0.093	Q9Y738.pdb.gz	MIS12_SCHPO Centromere protein mis12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis12 PE=1 SV=1
8	AFDB:Q9N3R7	0.383	0.443	4.254E-3	175	0.156	0.183	Q9N3R7.pdb.gz	Q9N3R7_CAEEL Human/fission yeast MIS (MInichromosome Stability) homolog OS=Caenorhabditis elegans OX=6239 GN=mis-12 PE=1 SV=1
9	AFDB:P32912	0.216	0.154	5.732E-1	316	0.137	0.089	P32912.pdb.gz	VAM7_YEAST Vacuolar morphogenesis protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAM7 PE=1 SV=1
10	AFDB:Q8IPW3	0.278	0.279	5.732E-1	204	0.161	0.162	Q8IPW3.pdb.gz	Q8IPW3_DROME Nnf1b OS=Drosophila melanogaster OX=7227 GN=Nnf1b PE=1 SV=1
11	AFDB:Q7JZC9	0.299	0.310	6.489E-1	194	0.107	0.113	Q7JZC9.pdb.gz	Q7JZC9_DROME Nnf1a OS=Drosophila melanogaster OX=7227 GN=Nnf1a PE=1 SV=1
12	PDB:6edtD	0.282	0.055	9.047E-1	1270	0.049	0.008	6edtD.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
13	PDB:1qsdA	0.175	0.280	1.397	102	0.068	0.137	1qsdA.pdb.gz
14	PDB:7m2wF	0.170	0.068	1.582	674	0.054	0.016	7m2wF.pdb.gz	CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation.
15	PDB:4h63H	0.199	0.229	1.791	174	0.112	0.132	4h63H.pdb.gz
16	PDB:6tuyA	0.224	0.089	1.791	667	0.083	0.025	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
17	PDB:1y11A	0.186	0.113	2.295	364	0.044	0.025	1y11A.pdb.gz
18	PDB:5a63D	0.183	0.322	3.131	100	0.044	0.090	5a63D.pdb.gz
19	PDB:5lj5O	0.162	0.122	3.331	283	0.132	0.095	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
20	PDB:3k29A	0.245	0.293	3.544	162	0.112	0.142	3k29A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H081	5.14e-151	419	205	1.000	1.000	MIS12_HUMAN Protein MIS12 homolog OS=Homo sapiens OX=9606 GN=MIS12 PE=1 SV=1
2	Q9QXZ0	0.28	34.3	7354	0.185	0.005	MACF1_MOUSE Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2
3	P39731	0.94	32.3	289	0.107	0.076	MTW1_YEAST Kinetochore-associated protein MTW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTW1 PE=1 SV=2
4	H2L0I2	1.2	32.3	2396	0.137	0.012	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
5	H2L0I3	1.3	32.3	2323	0.137	0.012	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
6	H2L0I4	1.3	32.3	2392	0.137	0.012	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
7	O94412	1.7	31.6	344	0.107	0.064	PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bet4 PE=3 SV=1
8	Q9XUS9	2.0	31.6	681	0.117	0.035	Q9XUS9_CAEEL Rac GTPase-activating protein 1 OS=Caenorhabditis elegans OX=6239 GN=cyk-4 PE=1 SV=1
9	Q9VHC4	2.6	31.6	1133	0.127	0.023	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
10	A0A178V0W2	3.5	30.8	806	0.073	0.019	A0A178V0W2_ARATH Kinesin-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30790 PE=1 SV=1
11	A8AZP4	3.5	31.2	3646	0.107	0.006	PADA_STRGC Platelet adherence protein A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=padA PE=1 SV=1
12	Q13488	3.5	30.8	830	0.122	0.030	VPP3_HUMAN V-type proton ATPase 116 kDa subunit a 3 OS=Homo sapiens OX=9606 GN=TCIRG1 PE=1 SV=3
13	Q6AWD5	3.7	30.8	1220	0.127	0.021	Q6AWD5_DROME AT02057p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8176 PE=1 SV=1
14	A0A0B4KFZ2	3.8	30.8	1161	0.127	0.022	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
15	Q8I5T7	3.9	30.8	1135	0.102	0.019	Q8I5T7_PLAF7 DNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211300 PE=3 SV=2
16	A2AN08	4.0	30.8	5180	0.078	0.003	UBR4_MOUSE E3 ubiquitin-protein ligase UBR4 OS=Mus musculus OX=10090 GN=Ubr4 PE=1 SV=1
17	D3ZHV2	5.3	30.4	5430	0.171	0.006	MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1
18	Q5T4S7	5.5	30.4	5183	0.068	0.003	UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1
19	Q811T9	5.6	30.4	852	0.073	0.018	DISC1_MOUSE Disrupted in schizophrenia 1 homolog OS=Mus musculus OX=10090 GN=Disc1 PE=1 SV=2
20	Q9HCE6	5.6	30.4	1279	0.122	0.020	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19697 Atg11_middle	4.7e+02	12.4	Atg11 middle domain
2	PF03993 DUF349	5.2e+02	12.3	Domain of Unknown Function (DUF349)
3	PF05859 Mis12	5.9e-31	118.9	Mis12 protein
4	PF10136 SpecificRecomb	2.2e+02	11.5	Site-specific recombinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355944	0.999	Kinetochore-associated protein NSL1 homolog
2	9606.ENSP00000389810	0.999	Kinetochore-associated protein DSN1 homolog
3	9606.ENSP00000273853	0.996	Centromere protein C
4	9606.ENSP00000465075	0.996	Kinetochore protein Spc24
5	9606.ENSP00000335463	0.995	Kinetochore scaffold 1
6	9606.ENSP00000357256	0.994	Polyamine-modulated factor 1
7	9606.ENSP00000261597	0.991	Kinetochore protein NDC80 homolog
8	9606.ENSP00000363055	0.990	ZW10 interactor
9	9606.ENSP00000271452	0.983	Kinetochore protein Nuf2
10	9606.ENSP00000282074	0.982	Kinetochore protein Spc25
11	9606.ENSP00000287598	0.959	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
12	9606.ENSP00000357259	0.941	Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
13	9606.ENSP00000302530	0.934	Mitotic checkpoint serine/threonine-protein kinase BUB1
14	9606.ENSP00000209875	0.930	Chromobox protein homolog 5
15	9606.ENSP00000313950	0.924	Aurora kinase B
16	9606.ENSP00000315644	0.815	Thymidylate synthase
17	9606.ENSP00000401018	0.776	GINS complex subunit 3
18	9606.ENSP00000236850	0.766	Apolipoprotein A-I
19	9606.ENSP00000306099	0.766	Fibrinogen beta chain
20	9606.ENSP00000306361	0.766	Fibrinogen alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1903047	0.991	mitotic cell cycle process
GO:0000070	0.974	mitotic sister chromatid segregation
GO:0065003	0.967	protein-containing complex assembly
GO:0065004	0.959	protein-DNA complex assembly
GO:0008608	0.947	attachment of spindle microtubules to kinetochore
GO:0007080	0.941	mitotic metaphase plate congression
GO:0034508	0.924	centromere complex assembly
GO:0051383	0.905	kinetochore organization
GO:0070925	0.876	organelle assembly
GO:0140694	0.866	non-membrane-bounded organelle assembly
GO:0051315	0.787	attachment of mitotic spindle microtubules to kinetochore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0000939	0.996	inner kinetochore
GO:0005654	0.965	nucleoplasm
GO:0000444	0.733	MIS12/MIND type complex
GO:0016604	0.544	nuclear body
GO:0015630	0.329	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]