StarFunc result for job id Q9H082

User Input

>input (229 residues)
MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPD
RTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMA
SFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAK
NPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LW77	0.848	0.848	9.982E-43	229	0.956	0.956	F1LW77.pdb.gz	F1LW77_RAT RAB33B, member RAS oncogene family OS=Rattus norvegicus OX=10116 GN=Rab33b PE=3 SV=2
2	AFDB:Q498P3	0.795	0.763	1.608E-35	239	0.707	0.678	Q498P3.pdb.gz	Q498P3_DANRE RAB33B, member RAS oncogene family a OS=Danio rerio OX=7955 GN=zgc:114080 PE=1 SV=1
3	AFDB:Q0P3Y1	0.760	0.738	1.197E-32	236	0.581	0.564	Q0P3Y1.pdb.gz	Q0P3Y1_DANRE RAB33A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab33a PE=2 SV=1
4	AFDB:Q14088	0.793	0.767	2.120E-32	237	0.590	0.570	Q14088.pdb.gz	RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens OX=9606 GN=RAB33A PE=1 SV=2
5	AFDB:O76173	0.735	0.833	2.926E-23	201	0.358	0.408	O76173.pdb.gz	RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum OX=44689 GN=Rab1C PE=2 SV=1
6	AFDB:A8K5R1	0.717	0.805	4.285E-23	203	0.362	0.409	A8K5R1.pdb.gz	A8K5R1_HUMAN RAB30, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB30 PE=2 SV=1
7	AFDB:P34140	0.712	0.787	4.285E-23	206	0.336	0.374	P34140.pdb.gz	RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum OX=44689 GN=rab1B PE=2 SV=2
8	AFDB:Q7T3A4	0.704	0.801	4.866E-23	200	0.310	0.355	Q7T3A4.pdb.gz	RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio OX=7955 GN=rab13 PE=1 SV=1
9	AFDB:A4FVK4	0.699	0.771	5.186E-23	207	0.341	0.377	A4FVK4.pdb.gz	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
10	AFDB:P62820	0.726	0.806	6.275E-23	205	0.332	0.371	P62820.pdb.gz	RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A PE=1 SV=3
11	PDB:5szhB	0.707	0.913	2.449E-21	175	0.328	0.429	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
12	PDB:5szjA	0.695	0.899	6.773E-21	175	0.314	0.411	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:2ew1A	0.682	0.904	8.196E-21	171	0.345	0.462	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
14	PDB:5sziA	0.693	0.902	4.281E-20	174	0.314	0.414	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:6if2B	0.682	0.869	1.848E-19	178	0.332	0.427	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
16	PDB:2f9mA	0.628	0.770	5.446E-19	182	0.284	0.357	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
17	PDB:1ukvY	0.688	0.791	9.056E-19	197	0.323	0.376	1ukvY.pdb.gz	Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
18	PDB:6s5fA	0.678	0.820	5.372E-18	188	0.336	0.410	6s5fA.pdb.gz	Structure of the human RAB39B in complex with GMPPNP
19	PDB:8a4cB	0.656	0.869	6.100E-18	170	0.262	0.353	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
20	PDB:7sd0B	0.659	0.851	1.916E-17	174	0.227	0.299	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H082	1.30e-175	483	229	1.000	1.000	RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens OX=9606 GN=RAB33B PE=1 SV=1
2	F1LW77	3.50e-158	439	229	0.956	0.956	F1LW77_RAT RAB33B, member RAS oncogene family OS=Rattus norvegicus OX=10116 GN=Rab33b PE=3 SV=2
3	O35963	3.75e-157	436	229	0.948	0.948	RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus OX=10090 GN=Rab33b PE=1 SV=1
4	Q498P3	5.52e-117	335	239	0.677	0.649	Q498P3_DANRE RAB33B, member RAS oncogene family a OS=Danio rerio OX=7955 GN=zgc:114080 PE=1 SV=1
5	Q14088	8.14e-94	276	237	0.541	0.523	RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens OX=9606 GN=RAB33A PE=1 SV=2
6	Q0P3Y1	2.89e-93	275	236	0.555	0.538	Q0P3Y1_DANRE RAB33A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab33a PE=2 SV=1
7	Q9SEH3	1.19e-51	168	202	0.371	0.421	RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana OX=3702 GN=RABD2C PE=1 SV=1
8	P62820	6.06e-51	166	205	0.336	0.376	RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A PE=1 SV=3
9	P62821	6.06e-51	166	205	0.336	0.376	RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus OX=10090 GN=Rab1A PE=1 SV=3
10	P62822	6.06e-51	166	205	0.336	0.376	RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris OX=9615 GN=RAB1A PE=1 SV=3
11	Q6NYB7	6.06e-51	166	205	0.336	0.376	RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus OX=10116 GN=Rab1A PE=1 SV=3
12	D6XMQ7	2.57e-50	164	208	0.341	0.375	D6XMQ7_TRYB2 Small GTP-binding protein Rab1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.530 PE=4 SV=1
13	Q67BJ9	2.57e-50	164	208	0.341	0.375	Q67BJ9_9TRYP Rab1 OS=Trypanosoma brucei OX=5691 PE=2 SV=1
14	A8K5R1	3.57e-50	164	203	0.354	0.399	A8K5R1_HUMAN RAB30, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB30 PE=2 SV=1
15	Q15771	3.57e-50	164	203	0.354	0.399	RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2
16	P01123	8.08e-50	163	206	0.345	0.383	YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT1 PE=1 SV=2
17	E9PMJ1	1.44e-49	161	168	0.345	0.470	E9PMJ1_HUMAN RAB30, member RAS oncogene family (Fragment) OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
18	Q9FPJ4	1.71e-49	162	202	0.362	0.411	RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana OX=3702 GN=RABD2B PE=1 SV=1
19	Q9VM50	7.17e-49	161	223	0.349	0.359	Q9VM50_DROME RE14786p OS=Drosophila melanogaster OX=7227 GN=Rab30 PE=2 SV=1
20	P10536	7.56e-49	160	201	0.328	0.373	RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus OX=10116 GN=Rab1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	5.9e-12	56.9	ADP-ribosylation factor family
2	PF03029 ATP_bind_1	1.1e+02	14.0	Conserved hypothetical ATP binding protein
3	PF00503 G-alpha	0.04	24.7	G-protein alpha subunit
4	PF00009 GTP_EFTU	0.00035	31.7	Elongation factor Tu GTP binding domain
5	PF04670 Gtr1_RagA	0.0023	28.9	Gtr1/RagA G protein conserved region
6	PF01926 MMR_HSR1	0.00031	32.2	50S ribosome-binding GTPase
7	PF10662 PduV-EutP	2.8e+02	12.7	Ethanolamine utilisation - propanediol utilisation
8	PF00071 Ras	1.5e-47	172.7	Ras family
9	PF08477 Roc	8e-29	111.7	Ras of Complex, Roc, domain of DAPkinase
10	PF09439 SRPRB	0.045	24.7	Signal recognition particle receptor beta subunit
11	PF05621 TniB	6.9	17.6	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000009029

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000016041	0.996	Autophagy related 16-like 1 (S. cerevisiae)
2	9593.ENSGGOP00000005440	0.821	RAB7A, member RAS oncogene family
3	9593.ENSGGOP00000024925	0.817	RAB9A, member RAS oncogene family
4	9593.ENSGGOP00000004465	0.815	RAB6A GEF complex partner 1
5	9593.ENSGGOP00000013901	0.790	RAB11A, member RAS oncogene family
6	9593.ENSGGOP00000014156	0.789	RAB11B, member RAS oncogene family
7	9593.ENSGGOP00000006675	0.786	RAB25, member RAS oncogene family
8	9593.ENSGGOP00000001889	0.775	Syntaxin 5
9	9593.ENSGGOP00000009284	0.771	RAB9B, member RAS oncogene family
10	9593.ENSGGOP00000016012	0.770	RAB36, member RAS oncogene family
11	9593.ENSGGOP00000016317	0.762	RAB34, member RAS oncogene family
12	9593.ENSGGOP00000019443	0.757	RAB10, member RAS oncogene family
13	9593.ENSGGOP00000006475	0.756	RAB15, member RAS oncogene family
14	9593.ENSGGOP00000022188	0.754	USO1 vesicle transport factor
15	9593.ENSGGOP00000002606	0.745	Belongs to the TRAPP small subunits family.
16	9593.ENSGGOP00000006305	0.743	Belongs to the TRAPP small subunits family.
17	9593.ENSGGOP00000004652	0.734	Trafficking protein particle complex subunit
18	9593.ENSGGOP00000016726	0.734	Trafficking protein particle complex subunit
19	9593.ENSGGOP00000004582	0.731	Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of proteins with the C- terminal sequence -XXCC, -XCXC and -CCXX.
20	9593.ENSGGOP00000013144	0.728	Rab GDP dissociation inhibitor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0017111	0.966	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.960	GTPase activity
GO:0097159	0.427	organic cyclic compound binding
GO:1901363	0.426	heterocyclic compound binding
GO:0043167	0.388	ion binding
GO:0019001	0.385	guanyl nucleotide binding
GO:0032561	0.376	guanyl ribonucleotide binding
GO:0043168	0.313	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.954	biological regulation
GO:0050789	0.917	regulation of biological process
GO:0051179	0.916	localization
GO:0006810	0.913	transport
GO:0050794	0.889	regulation of cellular process
GO:0051641	0.804	cellular localization
GO:0016192	0.748	vesicle-mediated transport
GO:0008152	0.711	metabolic process
GO:0032879	0.680	regulation of localization
GO:0051049	0.630	regulation of transport
GO:0044237	0.591	cellular metabolic process
GO:0060627	0.588	regulation of vesicle-mediated transport
GO:0071840	0.554	cellular component organization or biogenesis
GO:0016043	0.485	cellular component organization
GO:0006996	0.424	organelle organization
GO:0048193	0.395	Golgi vesicle transport
GO:0008104	0.352	protein localization
GO:0061919	0.336	process utilizing autophagic mechanism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0031090	0.997	organelle membrane
GO:0098588	0.991	bounding membrane of organelle
GO:0070013	0.978	intracellular organelle lumen
GO:0000139	0.922	Golgi membrane
GO:0005829	0.917	cytosol
GO:0031982	0.850	vesicle
GO:0005634	0.748	nucleus
GO:0005796	0.729	Golgi lumen
GO:0031981	0.416	nuclear lumen
GO:0031410	0.402	cytoplasmic vesicle
GO:0030054	0.370	cell junction
GO:0005654	0.305	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.966	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.966	nucleoside-triphosphate phosphatase.
RHEA:19669	0.960	GTP + H2O = GDP + H(+) + phosphate

[back to server]