StarFunc result for job id Q9H091

User Input

>input (742 residues)
MEFVSGYRDEFLDFTALLFGWFRKFVAERGAVGTSLEGRCRQLEAQIRRLPQDPALWVLH
VLPNHSVGISLGQGAEPGPGPGLGTAWLLGDNPPLHLRDLSPYISFVSLEDGEEGEEEEE
EDEEEEKREDGGAGSTEKVEPEEDRELAPTSRESPQETNPPGESEEAAREAGGGKDGCRE
DRVENETRPQKRKGQRSEAAPLHVSCLLLVTDEHGTILGIDLLVDGAQGTASWGSGTKDL
APWAYALLCHSMACPMGSGDPRKPRQLTVGDARLHRELESLVPRLGVKLAKTPMRTWGPR
PGFTFASLRARTCHVCHRHSFEAKLTPCPQCSAVLYCGEACLRADWQRCPDDVSHRFWCP
RLAAFMERAGELATLPFTYTAEVTSETFNKEAFLASRGLTRGYWTQLSMLIPGPGFSRHP
RGNTPSLSLLRGGDPYQLLQGDGTALMPPVPPHPPRGVFGSWQDYYTWRGLSLDSPIAVL
LTYPLTVYYVITHLVPQSFPELNIQNKQSLKIHVVEAGKEFDLVMVFWELLVLLPHVALE
LQFVGDGLPPESDEQHFTLQRDSLEVSVRPGSGISARPSSGTKEKGGRRDLQIKVSARPY
HLFQGPKPDLVIGFNSGFALKDTWLRSLPRLQSLRVPAFFTESSEYSCVMDGQTMAVATG
GGTSPPQPNPFRSPFRLRAADNCMSWYCNAFIFHLVYKPAQGSGARPAPGPPPPSPTPSA
PPAPTRRRRGEKKPGRGARRRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0R7	0.778	0.784	0.000	736	0.836	0.842	Q8C0R7.pdb.gz	ZMY15_MOUSE Zinc finger MYND domain-containing protein 15 OS=Mus musculus OX=10090 GN=Zmynd15 PE=1 SV=1
2	PDB:3gwzA	0.137	0.275	1.416E-3	339	0.027	0.059	3gwzA.pdb.gz	Structural characterization of the mitomycin 7-O-methyltransferase.
3	PDB:2aouB	0.157	0.343	1.498E-3	289	0.038	0.097	2aouB.pdb.gz	Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
4	PDB:2a14A	0.171	0.402	1.774E-3	257	0.053	0.152	2a14A.pdb.gz	The Crystal Structure of Human Indolethylamine N-methyltransferase in complex with SAH.
5	PDB:2bzgA	0.155	0.399	1.985E-3	229	0.019	0.061	2bzgA.pdb.gz	Structural Basis of Allele Variation of Human Thiopurine-S-Methyltransferase.
6	PDB:4g56A	0.108	0.127	2.486E-3	617	0.031	0.037	4g56A.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
7	PDB:4a6dA	0.150	0.283	2.630E-3	345	0.057	0.122	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
8	PDB:3lccA	0.152	0.416	2.944E-3	216	0.028	0.097	3lccA.pdb.gz	Halomethane Biosynthesis: Structure of a SAM-Dependent Halide Methyltransferase from Arabidopsis thaliana
9	PDB:2i62B	0.154	0.346	4.366E-3	261	0.046	0.130	2i62B.pdb.gz	The Crystal Structure of Mouse Nicotinamide N-methyltransferase in complex with SAH
10	PDB:6h2vA	0.149	0.420	4.366E-3	210	0.035	0.124	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
11	PDB:1tw2B	0.143	0.274	4.886E-3	350	0.034	0.071	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
12	AFDB:Q9SZF7	0.145	0.190	7.223E-2	531	0.077	0.107	Q9SZF7.pdb.gz	SHR_ARATH Protein SHORT-ROOT OS=Arabidopsis thaliana OX=3702 GN=SHR PE=1 SV=1
13	AFDB:Q3EDH0	0.170	0.180	1.420E-1	695	0.100	0.106	Q3EDH0.pdb.gz	SCL31_ARATH Scarecrow-like protein 31 OS=Arabidopsis thaliana OX=3702 GN=SCL31 PE=2 SV=3
14	AFDB:Q9SCR0	0.122	0.159	1.778E-1	542	0.098	0.135	Q9SCR0.pdb.gz	SCL7_ARATH Scarecrow-like protein 7 OS=Arabidopsis thaliana OX=3702 GN=SCL7 PE=1 SV=1
15	AFDB:Q8L7V3	0.132	0.120	3.303E-1	829	0.098	0.088	Q8L7V3.pdb.gz	PMTQ_ARATH Probable methyltransferase PMT26 OS=Arabidopsis thaliana OX=3702 GN=At5g64030 PE=2 SV=1
16	AFDB:P42519	0.123	0.146	8.602E-1	597	0.077	0.095	P42519.pdb.gz	STAR_DROME Protein Star OS=Drosophila melanogaster OX=7227 GN=S PE=2 SV=1
17	AFDB:Q3TPE9	0.072	0.118	2.117	440	0.030	0.050	Q3TPE9.pdb.gz	ANKY2_MOUSE Ankyrin repeat and MYND domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ankmy2 PE=1 SV=1
18	AFDB:Q8I7C6	0.049	0.052	2.370	700	0.049	0.051	Q8I7C6.pdb.gz	Q8I7C6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt2 PE=2 SV=1
19	AFDB:Q8GYX2	0.054	0.128	2.652	248	0.032	0.097	Q8GYX2.pdb.gz	FLZ14_ARATH FCS-Like Zinc finger 14 OS=Arabidopsis thaliana OX=3702 GN=FLZ14 PE=1 SV=1
20	AFDB:Q9FFU2	0.053	0.078	3.515	394	0.059	0.112	Q9FFU2.pdb.gz	Q9FFU2_ARATH tRNA-uridine aminocarboxypropyltransferase OS=Arabidopsis thaliana OX=3702 GN=MBG8.15 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C0R7	0.0	1173	736	0.837	0.844	ZMY15_MOUSE Zinc finger MYND domain-containing protein 15 OS=Mus musculus OX=10090 GN=Zmynd15 PE=1 SV=1
2	Q08C84	0.021	40.8	753	0.027	0.027	SMYD4_DANRE SET and MYND domain-containing protein 4 OS=Danio rerio OX=7955 GN=smyd4 PE=2 SV=1
3	Q4VC12	0.038	39.7	460	0.054	0.087	MSS51_HUMAN Putative protein MSS51 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=MSS51 PE=1 SV=2
4	Q2MJQ9	0.061	38.9	486	0.027	0.041	Q2MJQ9_DANRE Histone methyltransferase SmyD1a OS=Danio rerio OX=7955 GN=sth PE=1 SV=1
5	Q2MJQ8	0.069	38.9	473	0.027	0.042	Q2MJQ8_DANRE Histone methyltransferase SmyD1b OS=Danio rerio OX=7955 GN=symd1 PE=1 SV=1
6	Q8IYR2	0.30	37.0	804	0.023	0.021	SMYD4_HUMAN SET and MYND domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SMYD4 PE=1 SV=3
7	Q3TAD2	0.73	35.0	299	0.049	0.120	Q3TAD2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
8	Q13129	1.3	35.0	1914	0.050	0.019	RLF_HUMAN Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2
9	Q3V1H6	1.3	35.0	764	0.049	0.047	Q3V1H6_MOUSE C2H2-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
10	Q59GL0	1.3	35.0	1608	0.050	0.023	Q59GL0_HUMAN Rearranged L-myc fusion sequence variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
11	E9Q532	1.8	34.7	1808	0.049	0.020	E9Q532_MOUSE Rearranged L-myc fusion sequence OS=Mus musculus OX=10090 GN=Rlf PE=1 SV=1
12	A2A7F4	1.9	34.7	1918	0.049	0.019	A2A7F4_MOUSE Rearranged L-myc fusion sequence OS=Mus musculus OX=10090 GN=Rlf PE=1 SV=1
13	Q9BXT4	1.9	34.3	1180	0.022	0.014	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
14	Q6FIU8	2.1	34.3	4880	0.027	0.004	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
15	Q99MV1	2.2	34.3	1172	0.035	0.022	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
16	Q8BTK5	3.2	33.5	799	0.020	0.019	SMYD4_MOUSE SET and MYND domain-containing protein 4 OS=Mus musculus OX=10090 GN=Smyd4 PE=2 SV=2
17	P23470	4.5	33.1	1445	0.039	0.020	PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens OX=9606 GN=PTPRG PE=1 SV=4
18	O94256	6.4	32.3	483	0.018	0.027	SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set6 PE=3 SV=1
19	O94653	8.4	32.3	1121	0.040	0.027	BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bms1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20179 MSS51_C	1.1e-24	98.8	MSS51 C-terminal domain
2	PF01753 zf-MYND	2.2e-06	38.9	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369666	0.667	F-box/LRR-repeat protein 19
2	9606.ENSP00000315554	0.653	Spermatid maturation protein 1
3	9606.ENSP00000236979	0.593	Spermatid nuclear transition protein 1
4	9606.ENSP00000390778	0.566	Meiosis-specific with OB domain-containing protein
5	9606.ENSP00000293303	0.532	Kelch-like protein 10
6	9606.ENSP00000379226	0.528	Testis-expressed protein 11
7	9606.ENSP00000256246	0.504	Testis-expressed protein 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042826	1.000	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.986	regulation of biological process
GO:0051252	0.957	regulation of RNA metabolic process
GO:0048519	0.955	negative regulation of biological process
GO:0048523	0.935	negative regulation of cellular process
GO:0032501	0.932	multicellular organismal process
GO:0010556	0.922	regulation of macromolecule biosynthetic process
GO:0010468	0.920	regulation of gene expression
GO:0022414	0.901	reproductive process
GO:0032502	0.895	developmental process
GO:0031326	0.869	regulation of cellular biosynthetic process
GO:0048232	0.855	male gamete generation
GO:0048856	0.853	anatomical structure development
GO:0007283	0.852	spermatogenesis
GO:0031324	0.841	negative regulation of cellular metabolic process
GO:1903506	0.827	regulation of nucleic acid-templated transcription
GO:0022412	0.816	cellular process involved in reproduction in multicellular organism
GO:0010558	0.816	negative regulation of macromolecule biosynthetic process
GO:0031327	0.815	negative regulation of cellular biosynthetic process
GO:0006355	0.793	regulation of DNA-templated transcription
GO:0051172	0.789	negative regulation of nitrogen compound metabolic process
GO:0030154	0.786	cell differentiation
GO:1902679	0.745	negative regulation of RNA biosynthetic process
GO:0007286	0.685	spermatid development
GO:1903507	0.671	negative regulation of nucleic acid-templated transcription
GO:0045892	0.537	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043073	0.998	germ cell nucleus
GO:0001673	0.994	male germ cell nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]