StarFunc result for job id Q9H098

User Input

>input (131 residues)
MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKR
KRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRR
TGQEVAQAQES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TGF2	0.582	0.582	1.552E-17	131	0.985	0.985	Q3TGF2.pdb.gz	F107B_MOUSE Protein FAM107B OS=Mus musculus OX=10090 GN=Fam107b PE=1 SV=2
2	AFDB:A0A024R327	0.373	0.294	3.495E-9	175	0.534	0.400	A0A024R327.pdb.gz
3	PDB:7edxd	0.209	0.176	3.319	158	0.168	0.139	7edxd.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	AFDB:Q86P99	0.205	0.101	3.767	284	0.145	0.067	Q86P99.pdb.gz	Q86P99_DROME GM10395p OS=Drosophila melanogaster OX=7227 GN=Pdp1 PE=2 SV=1
5	PDB:7mq9SI	0.196	0.050	3.852	844	0.153	0.024	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	AFDB:Q9FGI9	0.245	0.105	4.058	344	0.191	0.073	Q9FGI9.pdb.gz	Q9FGI9_ARATH tRNA (guanine(9)-N(1))-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM10 PE=1 SV=1
7	AFDB:Q9D666	0.243	0.049	4.372	913	0.237	0.034	Q9D666.pdb.gz	SUN1_MOUSE SUN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sun1 PE=1 SV=2
8	AFDB:P24721	0.223	0.106	5.075	301	0.198	0.086	P24721.pdb.gz	ASGR2_MOUSE Asialoglycoprotein receptor 2 OS=Mus musculus OX=10090 GN=Asgr2 PE=1 SV=1
9	AFDB:K7ELS2	0.210	0.169	5.468	167	0.115	0.090	K7ELS2.pdb.gz	K7ELS2_HUMAN Vacuole membrane protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=VMP1 PE=1 SV=2
10	AFDB:P18289	0.237	0.123	5.468	289	0.122	0.055	P18289.pdb.gz	JRA_DROME Transcription factor Jra OS=Drosophila melanogaster OX=7227 GN=Jra PE=1 SV=2
11	PDB:7nvr1	0.184	0.104	5.593	265	0.145	0.072	7nvr1.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
12	AFDB:P49716	0.247	0.123	6.347	269	0.153	0.074	P49716.pdb.gz	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
13	PDB:7f5sLC	0.241	0.103	6.492	368	0.076	0.027	7f5sLC.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
14	PDB:7w5a2	0.199	0.199	6.994	123	0.122	0.130	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
15	PDB:6tdaS	0.217	0.047	7.535	783	0.183	0.031	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
16	AFDB:O94559	0.157	0.075	7.938	431	0.176	0.053	O94559.pdb.gz	LES1_SCHPO Nuclear bridge Ish domain protein les1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=les1 PE=3 SV=1
17	PDB:4h63H	0.142	0.107	9.424	174	0.153	0.115	4h63H.pdb.gz
18	PDB:5mrcQ	0.171	0.087	9.424	284	0.092	0.042	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:7c4jH	0.207	0.127	9.424	242	0.145	0.079	7c4jH.pdb.gz
20	PDB:7qooK	0.219	0.139	9.424	253	0.206	0.107	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TGF2	5.42e-87	251	131	0.985	0.985	F107B_MOUSE Protein FAM107B OS=Mus musculus OX=10090 GN=Fam107b PE=1 SV=2
2	O95990	6.37e-35	119	144	0.550	0.500	F107A_HUMAN Actin-associated protein FAM107A OS=Homo sapiens OX=9606 GN=FAM107A PE=1 SV=1
3	Q6IAM1	6.37e-35	119	144	0.550	0.500	Q6IAM1_HUMAN Family with sequence similarity 107 member A transcript variant OS=Homo sapiens OX=9606 GN=TU3A PE=2 SV=1
4	Q78TU8	1.03e-32	114	144	0.534	0.486	F107A_MOUSE Actin-associated protein FAM107A OS=Mus musculus OX=10090 GN=Fam107a PE=1 SV=1
5	M0R3K6	1.31e-32	113	131	0.542	0.542	F107A_RAT Actin-associated protein FAM107A OS=Rattus norvegicus OX=10116 GN=Fam107a PE=3 SV=2
6	A0A0R4IUB2	0.51	32.0	2580	0.168	0.009	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
7	E9QEX9	0.76	31.6	2607	0.160	0.008	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
8	Q9NR09	2.5	30.0	4857	0.183	0.005	BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=3
9	Q9NCW7	3.2	29.6	2501	0.221	0.012	Q9NCW7_DROME Mud protein OS=Drosophila melanogaster OX=7227 GN=mud PE=4 SV=1
10	M9PEK6	3.4	29.6	2501	0.221	0.012	M9PEK6_DROME Mushroom body defect, isoform L OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=1
11	Q1KN24	3.5	29.6	2501	0.221	0.012	Q1KN24_DROME Mushroom body defect protein OS=Drosophila melanogaster OX=7227 GN=mud PE=4 SV=1
12	Q8IR55	3.9	29.6	2567	0.221	0.011	Q8IR55_DROME Mushroom body defect, isoform H OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
13	Q9VY43	4.1	29.6	2394	0.221	0.012	Q9VY43_DROME Mushroom body defect, isoform F OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
14	O74423	4.7	29.3	702	0.214	0.040	ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ent1 PE=1 SV=2
15	M9NEG4	5.2	29.3	2165	0.221	0.013	M9NEG4_DROME Mushroom body defect, isoform J OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=1
16	Q99NH0	5.6	29.3	2603	0.176	0.009	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
17	Q9NCL3	5.6	29.3	1871	0.221	0.015	Q9NCL3_DROME Mud protein OS=Drosophila melanogaster OX=7227 GN=mud PE=2 SV=2
18	M9PJN0	6.0	28.9	1912	0.221	0.015	M9PJN0_DROME Mushroom body defect, isoform K OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=1
19	M9NGE4	6.5	28.9	2113	0.221	0.014	M9NGE4_DROME Mushroom body defect, isoform I OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=1
20	Q8IR54	6.7	28.9	1933	0.221	0.015	Q8IR54_DROME Mushroom body defect, isoform G OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06625 DUF1151	8.6e-37	136.9	Protein of unknown function (DUF1151)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008584988.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008578383.1	0.673	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008591550.1	0.673	CASP8 and FADD-like apoptosis regulator isoform X1
3	482537.XP_008582145.1	0.653	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 12 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
4	482537.XP_008573392.1	0.605	Neogenin
5	482537.XP_008582660.1	0.595	Regulator of G-protein signaling 8 isoform X1
6	482537.XP_008587023.1	0.582	Protein FAM78B
7	482537.XP_008581130.1	0.581	Probable cation-transporting ATPase 13A2
8	482537.XP_008576828.1	0.570	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 45% coverage of the annotated genomic feature by RNAseq alignments
9	482537.XP_008562396.1	0.567	Protein argonaute-2-like
10	482537.XP_008566666.1	0.567	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 42 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.969	multicellular organismal process
GO:0065007	0.789	biological regulation
GO:0007605	0.754	sensory perception of sound
GO:0050789	0.729	regulation of biological process
GO:0009987	0.710	cellular process
GO:0050794	0.699	regulation of cellular process
GO:0050896	0.492	response to stimulus
GO:0032502	0.342	developmental process
GO:0042221	0.304	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0120025	0.991	plasma membrane bounded cell projection
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005634	0.984	nucleus
GO:0005737	0.982	cytoplasm
GO:0043005	0.978	neuron projection
GO:0043228	0.924	non-membrane-bounded organelle
GO:0043232	0.901	intracellular non-membrane-bounded organelle
GO:0030054	0.881	cell junction
GO:0016020	0.863	membrane
GO:0031974	0.843	membrane-enclosed lumen
GO:0070013	0.785	intracellular organelle lumen
GO:0031981	0.769	nuclear lumen
GO:0005654	0.655	nucleoplasm
GO:0071944	0.508	cell periphery
GO:0005856	0.453	cytoskeleton
GO:0005886	0.381	plasma membrane
GO:0016607	0.347	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]