StarFunc result for job id Q9H0A0

User Input

>input (1025 residues)
MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYK
KELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGM
CVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVV
GRFNERFILSLASCKKCLVIDDQLNILPISSHVATMEALPPQTPDESLGPSDLELRELKE
SLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAALGLAIAG
AVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNV
FREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTG
RSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTLYEVSLQESIRYAPGDAVEKW
LNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKN
SPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKA
SGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLE
EKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLL
KFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLS
YQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMD
MIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIR
KVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDL
SEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMK
LKRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mq8NJ	0.763	0.941	0.000	827	0.805	0.998	7mq8NJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
2	AFDB:P53914	0.870	0.845	0.000	1056	0.571	0.554	P53914.pdb.gz	NAT10_YEAST RNA cytidine acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE33 PE=1 SV=1
3	AFDB:P87115	0.866	0.859	0.000	1033	0.552	0.548	P87115.pdb.gz	NAT10_SCHPO RNA cytidine acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nat10 PE=1 SV=1
4	AFDB:Q9H0A0	1.000	1.000	0.000	1025	1.000	1.000	Q9H0A0.pdb.gz	NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2
5	AFDB:Q582B4	0.827	0.817	5.499E-100	1039	0.451	0.445	Q582B4.pdb.gz	Q582B4_TRYB2 RNA cytidine acetyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.740 PE=3 SV=1
6	PDB:7ajtJA	0.717	0.898	1.349E-76	812	0.491	0.619	7ajtJA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
7	PDB:6zqbJB	0.718	0.874	3.421E-73	835	0.514	0.631	6zqbJB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
8	PDB:6lqpRM	0.626	0.817	6.005E-38	766	0.383	0.513	6lqpRM.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
9	AFDB:P76562	0.481	0.715	5.444E-37	671	0.162	0.247	P76562.pdb.gz	TMCA_ECOLI tRNA(Met) cytidine acetyltransferase TmcA OS=Escherichia coli (strain K12) OX=83333 GN=tmcA PE=1 SV=1
10	PDB:2zpaB	0.467	0.697	2.194E-32	662	0.165	0.255	2zpaB.pdb.gz	RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon
11	PDB:4dugA	0.102	0.191	2.323E-5	506	0.047	0.095	4dugA.pdb.gz	Dephosphorylation of the Core Clock Protein KaiC in the Cyanobacterial KaiABC Circadian Oscillator Proceeds via an ATP Synthase Mechanism.
12	PDB:5ld2D	0.112	0.172	1.180E-4	605	0.050	0.084	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
13	AFDB:O14114	0.084	0.074	1.658E-4	1190	0.111	0.096	O14114.pdb.gz	ATD2_SCHPO ATPase histone chaperone abo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abo1 PE=1 SV=1
14	PDB:5isvA	0.127	0.713	2.658E-4	156	0.033	0.218	5isvA.pdb.gz
15	PDB:7m8eF	0.097	0.102	3.376E-4	967	0.066	0.070	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
16	PDB:5hgzA	0.140	0.583	3.896E-4	211	0.023	0.114	5hgzA.pdb.gz	Structure and function of human Naa60 (NatF), a Golgi-localized bi-functional acetyltransferase
17	AFDB:O97159	0.112	0.067	4.077E-3	1982	0.128	0.066	O97159.pdb.gz	CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster OX=7227 GN=Mi-2 PE=1 SV=2
18	AFDB:F4K128	0.099	0.097	8.759E-3	1064	0.062	0.060	F4K128.pdb.gz	CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana OX=3702 GN=CHR23 PE=2 SV=1
19	AFDB:P34498	0.108	0.102	2.758E-2	1131	0.084	0.076	P34498.pdb.gz	MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans OX=6239 GN=mog-1 PE=1 SV=2
20	AFDB:G5ECB2	0.096	0.108	3.339E-2	842	0.095	0.115	G5ECB2.pdb.gz	GABR2_CAEEL Gamma-aminobutyric acid type B receptor subunit 2 OS=Caenorhabditis elegans OX=6239 GN=gbb-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PMU0	0.0	550	288	0.256	0.910	E9PMU0_HUMAN N-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=1
2	P53914	0.0	1138	1056	0.574	0.557	NAT10_YEAST RNA cytidine acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE33 PE=1 SV=1
3	P87115	0.0	1101	1033	0.561	0.557	NAT10_SCHPO RNA cytidine acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nat10 PE=1 SV=1
4	Q582B4	0.0	885	1039	0.453	0.447	Q582B4_TRYB2 RNA cytidine acetyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.740 PE=3 SV=1
5	Q9H0A0	0.0	2121	1025	1.000	1.000	NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2
6	P76562	3.15e-23	108	671	0.114	0.174	TMCA_ECOLI tRNA(Met) cytidine acetyltransferase TmcA OS=Escherichia coli (strain K12) OX=83333 GN=tmcA PE=1 SV=1
7	Q5ZPR3	0.51	36.6	534	0.033	0.064	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
8	Q6TLM1	0.91	34.7	165	0.025	0.158	Q6TLM1_AERHY AcrH OS=Aeromonas hydrophila OX=644 GN=acrH PE=1 SV=1
9	Q8VE98	2.1	34.3	316	0.033	0.108	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
10	Q4TU90	2.9	33.5	215	0.027	0.130	Q4TU90_MOUSE Reproductive homeobox 3A OS=Mus musculus OX=10090 GN=Rhox3a2 PE=2 SV=1
11	Q7D9D7	4.1	33.1	242	0.018	0.074	Q7D9D7_MYCTO DNA topoisomerase (ATP-hydrolyzing) OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0755 PE=4 SV=1
12	A0A0B4LGM5	4.5	33.9	1047	0.038	0.037	A0A0B4LGM5_DROME Holocarboxylase synthetase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hcs PE=1 SV=1
13	B7J5X1	4.5	31.6	107	0.015	0.140	B7J5X1_ACIF2 Iron-binding protein IscA OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=iscA PE=3 SV=1
14	Q55EU6	4.5	33.5	358	0.027	0.078	ACT23_DICDI Putative actin-23 OS=Dictyostelium discoideum OX=44689 GN=act23 PE=1 SV=1
15	Q38BC9	6.7	32.7	360	0.022	0.064	Q38BC9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2480 PE=4 SV=1
16	Q5FQD2	8.8	32.0	249	0.021	0.088	Q5FQD2_GLUOX 2OG-Fe dioxygenase family protein OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=GOX1674 PE=4 SV=1
17	P18287	9.5	32.3	311	0.024	0.080	APOE_RABIT Apolipoprotein E OS=Oryctolagus cuniculus OX=9986 GN=APOE PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	6.6	18.4	Acetyltransferase (GNAT) family
2	PF13508 Acetyltransf_7	0.47	22.1	Acetyltransferase (GNAT) domain
3	PF03623 Focal_AT	9.6	17.6	Focal adhesion targeting region
4	PF13718 GNAT_acetyltr_2	2.3e-97	336.4	GNAT acetyltransferase 2
5	PF05127 Helicase_RecD	2.3e-61	218.2	Helicase
6	PF08351 TmcA_N	1.1e-61	219.3	tRNA(Met) cytidine acetyltransferase TmcA, N-terminal
7	PF13725 tRNA_bind_2	4.8e-76	267.1	Possible tRNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232888	0.998	U3 small nucleolar RNA-interacting protein 2
2	9606.ENSP00000264279	0.998	Nucleolar protein 58
3	9606.ENSP00000363642	0.998	Ribosome biogenesis protein BMS1 homolog
4	9606.ENSP00000230340	0.997	Bystin
5	9606.ENSP00000261637	0.997	Small subunit processome component 20 homolog
6	9606.ENSP00000297990	0.997	Nucleolar protein 6
7	9606.ENSP00000371101	0.997	Nucleolar protein 10
8	9606.ENSP00000477848	0.997	Protein AATF
9	9606.ENSP00000225298	0.996	U3 small nucleolar RNA-associated protein 18 homolog
10	9606.ENSP00000261708	0.996	U3 small nucleolar RNA-associated protein 6 homolog
11	9606.ENSP00000327179	0.996	U3 small nucleolar RNA-associated protein 4 homolog
12	9606.ENSP00000355541	0.996	HEAT repeat-containing protein 1
13	9606.ENSP00000363746	0.996	WD repeat-containing protein 46
14	9606.ENSP00000405068	0.996	Nucleolar protein 14
15	9606.ENSP00000423067	0.996	WD repeat-containing protein 36
16	9606.ENSP00000358812	0.995	Protein RRP5 homolog
17	9606.ENSP00000370589	0.995	Nucleolar protein 56
18	9606.ENSP00000229214	0.994	KRR1 small subunit processome component homolog
19	9606.ENSP00000454836	0.994	Transducin beta-like protein 3
20	9606.ENSP00000386134	0.992	Neuroguidin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0008080	1.000	N-acetyltransferase activity
GO:0070182	0.999	DNA polymerase binding
GO:0106162	0.711	mRNA N-acetyltransferase activity
GO:1990883	0.557	rRNA cytidine N-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0050789	0.958	regulation of biological process
GO:0034641	0.958	cellular nitrogen compound metabolic process
GO:0010467	0.953	gene expression
GO:0006139	0.921	nucleobase-containing compound metabolic process
GO:0071840	0.905	cellular component organization or biogenesis
GO:0022613	0.897	ribonucleoprotein complex biogenesis
GO:0050794	0.889	regulation of cellular process
GO:0090304	0.889	nucleic acid metabolic process
GO:0016070	0.883	RNA metabolic process
GO:0006396	0.863	RNA processing
GO:0042254	0.845	ribosome biogenesis
GO:0034470	0.845	ncRNA processing
GO:0006364	0.835	rRNA processing
GO:0043412	0.817	macromolecule modification
GO:0009451	0.783	RNA modification
GO:0019222	0.673	regulation of metabolic process
GO:0060255	0.658	regulation of macromolecule metabolic process
GO:0051171	0.656	regulation of nitrogen compound metabolic process
GO:0048518	0.655	positive regulation of biological process
GO:0080090	0.653	regulation of primary metabolic process
GO:0031323	0.652	regulation of cellular metabolic process
GO:0010468	0.651	regulation of gene expression
GO:0048522	0.645	positive regulation of cellular process
GO:0019219	0.611	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.610	regulation of cellular biosynthetic process
GO:0010556	0.606	regulation of macromolecule biosynthetic process
GO:1901564	0.603	organonitrogen compound metabolic process
GO:0019538	0.574	protein metabolic process
GO:0048519	0.562	negative regulation of biological process
GO:0009893	0.550	positive regulation of metabolic process
GO:0048523	0.547	negative regulation of cellular process
GO:0010604	0.541	positive regulation of macromolecule metabolic process
GO:0051173	0.511	positive regulation of nitrogen compound metabolic process
GO:0031325	0.511	positive regulation of cellular metabolic process
GO:0009892	0.374	negative regulation of metabolic process
GO:0031324	0.360	negative regulation of cellular metabolic process
GO:0010605	0.359	negative regulation of macromolecule metabolic process
GO:0051172	0.352	negative regulation of nitrogen compound metabolic process
GO:0010608	0.348	post-transcriptional regulation of gene expression
GO:0010557	0.344	positive regulation of macromolecule biosynthetic process
GO:0034248	0.342	regulation of amide metabolic process
GO:0051052	0.339	regulation of DNA metabolic process
GO:2000112	0.336	regulation of cellular macromolecule biosynthetic process
GO:0031328	0.334	positive regulation of cellular biosynthetic process
GO:0006417	0.330	regulation of translation
GO:0051128	0.304	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0032991	0.999	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0016020	0.968	membrane
GO:1990904	0.911	ribonucleoprotein complex
GO:0005737	0.786	cytoplasm
GO:0005694	0.781	chromosome
GO:0140513	0.767	nuclear protein-containing complex
GO:1902494	0.686	catalytic complex
GO:0098687	0.487	chromosomal region
GO:0030496	0.417	midbody
GO:0005697	0.406	telomerase holoenzyme complex
GO:0005829	0.396	cytosol
GO:0000781	0.386	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:58480	0.711	a cytidine in mRNA + acetyl-CoA + ATP + H2O = ADP + an N(4)-acetylcytidine in mRNA + CoA + H(+) + phosphate

[back to server]