StarFunc result for job id Q9H0A9

User Input

>input (340 residues)
MAEGGELMSRLLSENADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGS
PGSGVPDFGRFTSVADTPSQLQTSSLEDLLCSHAPLSSEDDTSPGCAAPSQAPFKAFLSP
PEPHSHRGTDRKLSPLLSPLQDSLVDKTLLEPREMVRPKKVCFSESSLPTGDRTRRSYYL
NEIQSFAGAEKDARVVGEIAFQLDRRILAYVFPGVTRLYGFTVANIPEKIEQTSTKSLDG
SVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSP
AALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLFAW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0A9	0.999	0.999	1.042E-44	340	1.000	1.000	Q9H0A9.pdb.gz	SPC1L_HUMAN Speriolin-like protein OS=Homo sapiens OX=9606 GN=SPATC1L PE=1 SV=3
2	AFDB:Q9D9W0	0.554	0.551	3.238E-39	342	0.853	0.848	Q9D9W0.pdb.gz	SPC1L_MOUSE Speriolin-like protein OS=Mus musculus OX=10090 GN=Spatc1l PE=1 SV=1
3	AFDB:Q148B6	0.429	0.305	5.587E-16	480	0.306	0.217	Q148B6.pdb.gz	SPERI_MOUSE Speriolin OS=Mus musculus OX=10090 GN=Spatc1 PE=1 SV=1
4	AFDB:Q76KD6	0.431	0.249	6.190E-16	591	0.300	0.173	Q76KD6.pdb.gz	SPERI_HUMAN Speriolin OS=Homo sapiens OX=9606 GN=SPATC1 PE=2 SV=2
5	AFDB:O88492	0.119	0.042	6.002E-2	1403	0.141	0.034	O88492.pdb.gz	PLIN4_MOUSE Perilipin-4 OS=Mus musculus OX=10090 GN=Plin4 PE=1 SV=2
6	AFDB:Q18086	0.119	0.108	9.040E-2	389	0.153	0.134	Q18086.pdb.gz	GLOB6_CAEEL Globin-like protein 6 OS=Caenorhabditis elegans OX=6239 GN=glb-6 PE=1 SV=2
7	AFDB:Q9LUI2	0.114	0.034	9.040E-2	1728	0.124	0.024	Q9LUI2.pdb.gz	NET1A_ARATH Protein NETWORKED 1A OS=Arabidopsis thaliana OX=3702 GN=NET1A PE=1 SV=1
8	AFDB:Q9VTK2	0.110	0.052	1.588E-1	886	0.129	0.050	Q9VTK2.pdb.gz	POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=rt PE=2 SV=2
9	PDB:7zxkC	0.082	0.158	1.661E-1	166	0.076	0.157	7zxkC.pdb.gz
10	AFDB:P97287	0.116	0.118	2.051E-1	331	0.124	0.127	P97287.pdb.gz	MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Mus musculus OX=10090 GN=Mcl1 PE=1 SV=3
11	AFDB:Q90YL6	0.131	0.102	2.159E-1	517	0.159	0.104	Q90YL6.pdb.gz	Q90YL6_DANRE Nr5a2 protein OS=Danio rerio OX=7955 GN=zFF1 PE=2 SV=1
12	PDB:5xjt2	0.107	0.151	3.402E-1	217	0.065	0.101	5xjt2.pdb.gz	Structures of 7S mutant complexes
13	PDB:7c6dA	0.105	0.138	5.676E-1	241	0.103	0.145	7c6dA.pdb.gz	Structure-based rational design of chitosanase CsnMY002 for high yields of chitobiose.
14	PDB:1a9wE	0.122	0.229	6.618E-1	145	0.053	0.124	1a9wE.pdb.gz	Crystal structure of a human embryonic haemoglobin: the carbonmonoxy form of gower II (alpha2 epsilon2) haemoglobin at 2.9 A resolution.
15	PDB:1hbrD	0.132	0.240	6.618E-1	146	0.056	0.130	1hbrD.pdb.gz	The structural and functional analysis of the hemoglobin D component from chicken.
16	PDB:6xz6A	0.102	0.132	7.717E-1	213	0.065	0.103	6xz6A.pdb.gz
17	PDB:7zkwA	0.117	0.144	7.717E-1	243	0.056	0.078	7zkwA.pdb.gz	Structural basis for proton coupled cystine transport by cystinosin.
18	PDB:1sqfA	0.118	0.101	8.123E-1	425	0.076	0.061	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
19	PDB:5b46A	0.122	0.081	1.104	627	0.041	0.022	5b46A.pdb.gz	Crystal structures of archaeal 2-oxoacid:ferredoxin oxidoreductases from Sulfolobus tokodaii
20	PDB:3godA	0.101	0.105	1.223	320	0.097	0.103	3godA.pdb.gz	Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D9W0	0.0	556	342	0.853	0.848	SPC1L_MOUSE Speriolin-like protein OS=Mus musculus OX=10090 GN=Spatc1l PE=1 SV=1
2	Q9H0A9	0.0	689	340	1.000	1.000	SPC1L_HUMAN Speriolin-like protein OS=Homo sapiens OX=9606 GN=SPATC1L PE=1 SV=3
3	Q76KD6	1.94e-36	140	591	0.232	0.134	SPERI_HUMAN Speriolin OS=Homo sapiens OX=9606 GN=SPATC1 PE=2 SV=2
4	Q148B6	1.77e-35	136	480	0.224	0.158	SPERI_MOUSE Speriolin OS=Mus musculus OX=10090 GN=Spatc1 PE=1 SV=1
5	Q9NP81	0.47	34.7	518	0.132	0.087	SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1
6	Q5SNZ0	0.64	34.7	1873	0.056	0.010	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
7	Q9N0F3	0.78	33.9	518	0.132	0.087	SYSM_BOVIN Serine--tRNA ligase, mitochondrial OS=Bos taurus OX=9913 GN=SARS2 PE=1 SV=1
8	D3ZYD7	4.2	32.0	1523	0.053	0.012	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
9	A0A8I5ZW24	4.6	32.0	1845	0.053	0.010	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
10	A0A8I6A5W7	4.6	32.0	1873	0.053	0.010	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
11	A0A571BF46	9.6	30.8	7488	0.056	0.003	A0A571BF46_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
12	A0A571BF58	9.6	30.8	7523	0.056	0.003	A0A571BF58_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
13	A2AQA9	9.6	30.8	6909	0.056	0.003	A2AQA9_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
14	E9Q1W3	9.6	30.8	7152	0.056	0.003	E9Q1W3_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
15	F1SC07	9.8	30.8	4518	0.062	0.005	DYH11_PIG Dynein axonemal heavy chain 11 OS=Sus scrofa OX=9823 GN=DNAH11 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15059 Speriolin_C	5.2e-61	216.5	Speriolin C-terminus
2	PF15058 Speriolin_N	1.6e-30	118.4	Speriolin N terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291672

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297873	0.604	Methyltransferase-like protein 27
2	9606.ENSP00000329614	0.594	Endoribonuclease YbeY
3	9606.ENSP00000269844	0.582	PR domain zinc finger protein 15
4	9606.ENSP00000402915	0.553	Uncharacterized protein C2orf74
5	9606.ENSP00000230582	0.543	Thymus-specific serine protease
6	9606.ENSP00000381047	0.538	Protein C21orf2
7	9606.ENSP00000432104	0.505	Endogenous Bornavirus-like nucleoprotein 2
8	9606.ENSP00000418693	0.503	RWD domain containing 2B
9	9606.ENSP00000355840	0.501	Coiled-coil domain containing 185

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0019222	0.956	regulation of metabolic process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0080090	0.935	regulation of primary metabolic process
GO:0051171	0.935	regulation of nitrogen compound metabolic process
GO:0031323	0.935	regulation of cellular metabolic process
GO:0048522	0.931	positive regulation of cellular process
GO:0032501	0.898	multicellular organismal process
GO:0071840	0.837	cellular component organization or biogenesis
GO:0051246	0.835	regulation of protein metabolic process
GO:0016043	0.824	cellular component organization
GO:0032502	0.798	developmental process
GO:0051174	0.737	regulation of phosphorus metabolic process
GO:0065009	0.682	regulation of molecular function
GO:0009893	0.679	positive regulation of metabolic process
GO:0051338	0.650	regulation of transferase activity
GO:0019220	0.624	regulation of phosphate metabolic process
GO:0006996	0.623	organelle organization
GO:0031399	0.620	regulation of protein modification process
GO:0007276	0.616	gamete generation
GO:0048583	0.610	regulation of response to stimulus
GO:0042325	0.579	regulation of phosphorylation
GO:0003006	0.560	developmental process involved in reproduction
GO:0023051	0.558	regulation of signaling
GO:0010646	0.558	regulation of cell communication
GO:0051173	0.556	positive regulation of nitrogen compound metabolic process
GO:0031325	0.556	positive regulation of cellular metabolic process
GO:0010604	0.550	positive regulation of macromolecule metabolic process
GO:0048232	0.512	male gamete generation
GO:0043549	0.503	regulation of kinase activity
GO:0007010	0.462	cytoskeleton organization
GO:0009966	0.430	regulation of signal transduction
GO:0043085	0.394	positive regulation of catalytic activity
GO:0045859	0.337	regulation of protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005929	0.990	cilium
GO:0005815	0.987	microtubule organizing center
GO:0005813	0.968	centrosome
GO:0097729	0.927	9+2 motile cilium
GO:0036126	0.901	sperm flagellum
GO:0043231	0.808	intracellular membrane-bounded organelle
GO:0005634	0.655	nucleus
GO:0005737	0.652	cytoplasm
GO:0097224	0.540	sperm connecting piece
GO:0031981	0.450	nuclear lumen
GO:0005829	0.384	cytosol
GO:0005654	0.303	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]