StarFunc result for job id Q9H0B3

User Input

>input (1180 residues)
MTLQGRADLSGNQGNAAGRLATVHEPVVTQWAVHPPAPAHPSLLDKMEKAPPQPQHEGLK
SKEHLPQQPAEGKTASRRVPRLRAVVESQAFKNILVDEMDMMHARAATLIQANWRGYWLR
QKLISQMMAAKAIQEAWRRFNKRHILHSSKSLVKKTRAEEGDIPYHAPQQVRFQHPEENR
LLSPPIMVNKETQFPSCDNLVLCRPQSSPLLQPPAAQGTPEPCVQGPHAARVRGLAFLPH
QTVTIRFPCPVSLDAKCQPCLLTRTIRSTCLVHIEGDSVKTKRVSARTNKARAPETPLSR
RYDQAVTRPSRAQTQGPVKAETPKAPFQICPGPMITKTLLQTYPVVSVTLPQTYPASTMT
TTPPKTSPVPKVTIIKTPAQMYPGPTVTKTAPHTCPMPTMTKIQVHPTASRTGTPRQTCP
ATITAKNRPQVSLLASIMKSLPQVCPGPAMAKTPPQMHPVTTPAKNPLQTCLSATMSKTS
SQRSPVGVTKPSPQTRLPAMITKTPAQLRSVATILKTLCLASPTVANVKAPPQVAVAAGT
PNTSGSIHENPPKAKATVNVKQAAKVVKASSPSYLAEGKIRCLAQPHPGTGVPRAAAELP
LEAEKIKTGTQKQAKTDMAFKTSVAVEMAGAPSWTKVAEEGDKPPHVYVPVDMAVTLPRG
QLAAPLTNASSQRHPPCLSQRPLAAPLTKASSQGHLPTELTKTPSLAHLDTCLSKMHSQT
HLATGAVKVQSQAPLATCLTKTQSRGQPITDITTCLIPAHQAADLSSNTHSQVLLTGSKV
SNHACQRLGGLSAPPWAKPEDRQTQPQPHGHVPGKTTQGGPCPAACEVQGMLVPPMAPTG
HSTCNVESWGDNGATRAQPSMPGQAVPCQEDTGPADAGVVGGQSWNRAWEPARGAASWDT
WRNKAVVPPRRSGEPMVSMQAAEEIRILAVITIQAGVRGYLARRRIRLWHRGAMVIQATW
RGYRVRRNLAHLCRATTTIQSAWRGYSTRRDQARHWQMLHPVTWVELGSRAGVMSDRSWF
QDGRARTVSDHRCFQSCQAHACSVCHSLSSRIGSPPSVVMLVGSSPRTCHTCGRTQPTRV
VQGMGQGTEGPGAVSWASAYQLAALSPRQPHRQDKAATAIQSAWRGFKIRQQMRQQQMAA
KIVQATWRGHHTRSCLKNTEALLGPADPSASSRHMHWPGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0B3	1.000	1.000	0.000	1180	1.000	1.000	Q9H0B3.pdb.gz	IQCN_HUMAN IQ domain-containing protein N OS=Homo sapiens OX=9606 GN=IQCN PE=1 SV=1
2	AFDB:A0JP07	0.193	0.271	6.296E-99	794	0.672	0.999	A0JP07.pdb.gz	A0JP07_HUMAN KIAA1683 protein OS=Homo sapiens OX=9606 GN=KIAA1683 PE=1 SV=1
3	AFDB:Q8NEY1	0.089	0.063	1.501E-2	1877	0.168	0.105	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
4	AFDB:Q9VV52	0.065	0.068	3.063E-2	1117	0.133	0.141	Q9VV52.pdb.gz	Q9VV52_DROME LD37257p OS=Drosophila melanogaster OX=7227 GN=RAF2 PE=1 SV=3
5	AFDB:Q5TZ18	0.078	0.045	7.744E-2	2269	0.170	0.089	Q5TZ18.pdb.gz	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
6	AFDB:Q569L8	0.040	0.036	1.957E-1	1344	0.145	0.127	Q569L8.pdb.gz	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
7	AFDB:F1QGD0	0.034	0.029	2.424E-1	1457	0.123	0.100	F1QGD0.pdb.gz
8	AFDB:Q5XPJ6	0.058	0.058	3.995E-1	1170	0.119	0.120	Q5XPJ6.pdb.gz	SCAR4_ARATH Protein SCAR4 OS=Arabidopsis thaliana OX=3702 GN=SCAR4 PE=1 SV=1
9	AFDB:Q6ZPE7	0.040	0.051	3.995E-1	858	0.120	0.166	Q6ZPE7.pdb.gz	Q6ZPE7_MOUSE MKIAA3015 protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
10	AFDB:F1M078	0.059	0.059	4.290E-1	1164	0.120	0.122	F1M078.pdb.gz	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
11	PDB:7w5a2	0.050	0.362	7.370	123	0.019	0.179	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
12	PDB:7r5jA0	0.045	0.061	9.128	818	0.012	0.017	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JP07	0.0	1057	794	0.435	0.646	A0JP07_HUMAN KIAA1683 protein OS=Homo sapiens OX=9606 GN=KIAA1683 PE=1 SV=1
2	Q9H0B3	0.0	2394	1180	1.000	1.000	IQCN_HUMAN IQ domain-containing protein N OS=Homo sapiens OX=9606 GN=IQCN PE=1 SV=1
3	Q95ZU1	1.06e-07	58.9	1809	0.025	0.017	Q95ZU1_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hum-2 PE=1 SV=4
4	Q17383	1.17e-07	58.9	1839	0.025	0.016	Q17383_CAEEL Hum-2 OS=Caenorhabditis elegans OX=6239 PE=2 SV=1
5	Q8IZT6	3.06e-07	57.8	3477	0.047	0.016	ASPM_HUMAN Abnormal spindle-like microcephaly-associated protein OS=Homo sapiens OX=9606 GN=ASPM PE=1 SV=2
6	Q63358	1.05e-06	55.8	1980	0.025	0.015	MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus OX=10116 GN=Myo9b PE=1 SV=1
7	A0A0R4INR1	1.62e-06	55.5	3391	0.047	0.017	A0A0R4INR1_DANRE Abnormal spindle-like microcephaly-associated protein OS=Danio rerio OX=7955 GN=fc13b04 PE=4 SV=1
8	Q8CJ27	2.29e-06	54.7	3122	0.061	0.023	ASPM_MOUSE Abnormal spindle-like microcephaly-associated protein homolog OS=Mus musculus OX=10090 GN=Aspm PE=1 SV=2
9	M0R0P8	1.32e-05	52.4	2157	0.021	0.012	M0R0P8_HUMAN Myosin IXB OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=1
10	M0R300	1.32e-05	52.4	2071	0.021	0.012	M0R300_HUMAN Myosin IXB (Fragment) OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=8
11	Q13459	1.32e-05	52.4	2157	0.021	0.012	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
12	Q9QY06	1.66e-05	52.0	2114	0.024	0.013	MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus OX=10090 GN=Myo9b PE=1 SV=2
13	Q99104	7.28e-05	49.7	1853	0.024	0.015	MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus OX=10090 GN=Myo5a PE=1 SV=2
14	Q9QYF3	7.78e-05	49.7	1828	0.024	0.015	MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus OX=10116 GN=Myo5a PE=1 SV=1
15	F8VQB6	1.47e-04	48.9	2062	0.028	0.016	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
16	P79114	1.51e-04	48.9	2052	0.027	0.016	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
17	A0A0A0MQX1	1.83e-04	48.5	2069	0.027	0.015	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
18	Q9HD67	1.88e-04	48.5	2058	0.027	0.016	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
19	E9PEW5	2.21e-04	48.1	1397	0.027	0.023	E9PEW5_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
20	Q5AKW2	2.68e-04	47.8	1561	0.019	0.015	Q5AKW2_CANAL Myosin 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13272 Holin_2-3	6e+02	12.1	Putative 2/3 transmembrane domain holin
2	PF00612 IQ	5.2e-23	89.6	IQ calmodulin-binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000010907

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000010684	0.662	Zinc finger protein 559
2	9601.ENSPPYP00000024047	0.522	Uncharacterized protein
3	9601.ENSPPYP00000011696	0.514	Zinc finger protein 444
4	9601.ENSPPYP00000013689	0.513	Uncharacterized protein
5	9601.ENSPPYP00000014314	0.502	Speckle-type POZ protein-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0050789	0.818	regulation of biological process
GO:0050794	0.810	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005739	0.996	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]