StarFunc result for job id Q9H0C2

User Input

>input (315 residues)
MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPE
ARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQ
FWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSD
GIAGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILS
YPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVL
YDKIKEFFHIDIGGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0C2	1.000	1.000	1.375E-42	315	1.000	1.000	Q9H0C2.pdb.gz	ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens OX=9606 GN=SLC25A31 PE=1 SV=1
2	AFDB:Q3V132	0.988	0.972	1.185E-38	320	0.889	0.875	Q3V132.pdb.gz	ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus OX=10090 GN=Slc25a31 PE=1 SV=1
3	AFDB:Q26365	0.932	0.941	2.012E-31	312	0.689	0.696	Q26365.pdb.gz	ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster OX=7227 GN=sesB PE=2 SV=4
4	AFDB:P05141	0.915	0.966	2.393E-31	298	0.670	0.708	P05141.pdb.gz	ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7
5	AFDB:A0A0S2Z3H3	0.910	0.961	3.089E-30	298	0.689	0.728	A0A0S2Z3H3.pdb.gz	A0A0S2Z3H3_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A4 PE=2 SV=1
6	AFDB:G5EFU2	0.928	0.933	5.198E-30	313	0.641	0.645	G5EFU2.pdb.gz	G5EFU2_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.4 PE=1 SV=1
7	AFDB:O01813	0.913	0.958	5.173E-29	300	0.584	0.613	O01813.pdb.gz	O01813_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.2 PE=1 SV=1
8	PDB:2c3eA	0.881	0.946	1.415E-27	293	0.667	0.717	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
9	AFDB:O97470	0.871	0.887	1.964E-26	309	0.597	0.608	O97470.pdb.gz	ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum OX=44689 GN=ancA PE=1 SV=1
10	AFDB:Q5A516	0.871	0.910	1.700E-23	301	0.527	0.551	Q5A516.pdb.gz	Q5A516_CANAL ADP/ATP translocase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PET9 PE=3 SV=1
11	AFDB:Q6FUE0	0.857	0.882	2.860E-23	306	0.514	0.529	Q6FUE0.pdb.gz	Q6FUE0_CANGA ADP/ATP translocase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F04213g PE=3 SV=1
12	PDB:4c9qB	0.836	0.906	5.271E-21	290	0.486	0.528	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.547	0.583	3.762E-14	292	0.502	0.541	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:7lciR	0.165	0.144	9.624E-2	393	0.149	0.120	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
15	PDB:7finR	0.154	0.141	6.771E-1	380	0.114	0.095	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
16	PDB:1is2A	0.230	0.142	7.071E-1	637	0.137	0.068	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
17	PDB:6kpcA	0.113	0.093	7.071E-1	445	0.178	0.126	6kpcA.pdb.gz	Activation and Signaling Mechanism Revealed by Cannabinoid Receptor-GiComplex Structures.
18	PDB:5x3xM	0.212	0.292	7.384E-1	207	0.079	0.121	5x3xM.pdb.gz
19	PDB:6wpwR	0.150	0.130	7.712E-1	398	0.098	0.078	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
20	PDB:7bc7A	0.149	0.123	8.053E-1	432	0.152	0.111	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V132	0.0	577	320	0.873	0.859	ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus OX=10090 GN=Slc25a31 PE=1 SV=1
2	Q9H0C2	0.0	644	315	1.000	1.000	ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens OX=9606 GN=SLC25A31 PE=1 SV=1
3	P48962	6.52e-159	447	298	0.679	0.718	ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4
4	A0A0S2Z3H3	9.88e-159	446	298	0.686	0.725	A0A0S2Z3H3_HUMAN ADP/ATP translocase (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A4 PE=2 SV=1
5	P12235	9.88e-159	446	298	0.686	0.725	ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4
6	Q5ZMJ6	2.62e-158	446	298	0.679	0.718	Q5ZMJ6_CHICK ADP/ATP translocase OS=Gallus gallus OX=9031 GN=SLC25A4 PE=1 SV=1
7	P02722	1.01e-157	444	298	0.679	0.718	ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus OX=9913 GN=SLC25A4 PE=1 SV=3
8	Q26365	1.18e-157	444	312	0.683	0.689	ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster OX=7227 GN=sesB PE=2 SV=4
9	Q05962	1.24e-157	444	298	0.676	0.715	ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus OX=10116 GN=Slc25a4 PE=1 SV=3
10	P12236	1.53e-157	444	298	0.670	0.708	ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4
11	Q6I9V5	1.53e-157	444	298	0.670	0.708	Q6I9V5_HUMAN ADP/ATP translocase OS=Homo sapiens OX=9606 GN=SLC25A6 PE=2 SV=1
12	P51881	6.20e-157	442	298	0.673	0.711	ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3
13	Q09073	2.00e-156	441	298	0.673	0.711	ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus OX=10116 GN=Slc25a5 PE=1 SV=3
14	P05141	1.66e-155	438	298	0.667	0.705	ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7
15	G5EFU2	2.51e-143	408	313	0.644	0.649	G5EFU2_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.4 PE=1 SV=1
16	O45865	2.28e-139	397	300	0.619	0.650	O45865_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.1 PE=1 SV=1
17	O01813	4.31e-132	379	300	0.587	0.617	O01813_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.2 PE=1 SV=1
18	O97470	2.15e-130	375	309	0.603	0.615	ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum OX=44689 GN=ancA PE=1 SV=1
19	Q5A516	3.44e-106	313	301	0.530	0.555	Q5A516_CANAL ADP/ATP translocase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PET9 PE=3 SV=1
20	Q6FUE0	1.10e-102	305	306	0.524	0.539	Q6FUE0_CANGA ADP/ATP translocase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F04213g PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	7e-69	239.2	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016464

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015672	0.897	Voltage-dependent anion channel 3
2	61853.ENSNLEP00000020494	0.897	Voltage-dependent anion channel 2
3	61853.ENSNLEP00000009803	0.881	Voltage-dependent anion channel 1
4	61853.ENSNLEP00000012898	0.881	Peptidyl-prolyl cis-trans isomerase
5	61853.ENSNLEP00000018131	0.878	Uncharacterized protein
6	61853.ENSNLEP00000021189	0.875	ATP synthase subunit beta
7	61853.ENSNLEP00000007800	0.859	Peptidylprolyl isomerase D
8	61853.ENSNLEP00000013617	0.858	ATP synthase subunit alpha
9	61853.ENSNLEP00000006132	0.847	Translocator protein 2
10	61853.ENSNLEP00000019522	0.847	Translocator protein (18kDa)
11	61853.ENSNLEP00000020530	0.808	Protein kinase C epsilon type
12	61853.ENSNLEP00000013529	0.803	Solute carrier family 25 (mitochondrial carrier
13	61853.ENSNLEP00000018076	0.803	Solute carrier family 25 (mitochondrial carrier
14	61853.ENSNLEP00000012727	0.785	Cytochrome c-1
15	61853.ENSNLEP00000007272	0.783	Solute carrier family 25 (mitochondrial carrier
16	61853.ENSNLEP00000019706	0.714	RAB28, member RAS oncogene family
17	61853.ENSNLEP00000014869	0.672	Ubiquinol-cytochrome c reductase core protein II
18	61853.ENSNLEP00000019403	0.668	Mitochondrial import inner membrane translocase subunit TIM23
19	61853.ENSNLEP00000015522	0.643	Translocase of inner mitochondrial membrane 10 homolog (yeast)
20	61853.ENSNLEP00000018844	0.635	Aconitate hydratase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	1.000	transmembrane transporter activity
GO:0005515	0.998	protein binding
GO:0008514	0.993	organic anion transmembrane transporter activity
GO:1901702	0.968	salt transmembrane transporter activity
GO:0015605	0.946	organophosphate ester transmembrane transporter activity
GO:0015215	0.941	nucleotide transmembrane transporter activity
GO:0022804	0.929	active transmembrane transporter activity
GO:0015291	0.922	secondary active transmembrane transporter activity
GO:0015216	0.895	purine nucleotide transmembrane transporter activity
GO:0000295	0.891	adenine nucleotide transmembrane transporter activity
GO:1901505	0.576	carbohydrate derivative transmembrane transporter activity
GO:0005347	0.568	ATP transmembrane transporter activity
GO:0097159	0.311	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051179	0.916	localization
GO:0007005	0.880	mitochondrion organization
GO:0006810	0.877	transport
GO:0008152	0.740	metabolic process
GO:0065007	0.652	biological regulation
GO:0071702	0.542	organic substance transport
GO:0044237	0.479	cellular metabolic process
GO:0050789	0.440	regulation of biological process
GO:0071704	0.439	organic substance metabolic process
GO:0050794	0.419	regulation of cellular process
GO:0071705	0.398	nitrogen compound transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.998	membrane
GO:0005634	0.992	nucleus
GO:0031090	0.962	organelle membrane
GO:0005740	0.901	mitochondrial envelope
GO:0031966	0.890	mitochondrial membrane
GO:0019866	0.858	organelle inner membrane
GO:0005743	0.852	mitochondrial inner membrane
GO:0032991	0.335	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]