StarFunc result for job id Q9H0D2

User Input

>input (1346 residues)
MDQYSLGDEGALPSEMHLPSFSESQGLNCSDTLNRDLGPNTRGFLYAGLSGLDPDPSLPT
PDMSSEVLEDNLDTLSLYSGKDSDSVKLLEEYADSESQASLQDLGLGVLKAKEADEGGRA
TSGSARKGKRQHSSPQNPLLDCSLCGKVFSSASSLSKHYLTHSQERKHVCKICSKAFKRQ
DHLTGHMLTHQKTKPFVCIEQGCSKSYCDYRSLRRHYEVHHGLCILKEAPPEEEACGDSP
HAHESAGQPPPSSLRSLVPPEARSPGSLLPHRDLLRRIVSSIVHQKTPSPGPAPAGASDS
EGRNTACPCPASSGSSSCTPAGPHAAPAALDTELPEEPCLPQKEPATDVFTAPNSRAAEN
GAPDPPEPEPDTALLQARSTAECWPEGGSVPACLPLFRGQTVPASSQPSSHSFQWLRNLP
GCPKSKGNNVFVVHKPSAVPSREGSESGPGPSSGSPSEESPPGPGGGLEDALPFPAALLR
VPAEAPSDPRSASGEDDPCAPKKVKVDCDSFLCQNPGEPGLQEAQKAGGLPADASPLFRQ
LFLKSQEPLVSHEQMQVFQMITKSQRIFSHAQVAAVSSQLPAPEGKPAALRPLQGPWPQQ
PPPLAPAVDSLHAGPGNPEAEGSPARRRKTTPGVPREASPGSTRRDAKGGLKVAAVPTPL
AAPSLDPSRNPDISSLAKQLRSSKGTLDLEDIFPSTGQRQTQLGGEEPPGASLPGKQAPA
ENGAASRITKGEKGPACSRGGGYRLLGNPRAPRFSGFRKEKAKMDMCCAASPSQVAMASF
SSAGPPADPSKSKLTIFSRIQGGNIYRLPHPVKEENVAGRGNQQNGSPTDWTKPRSTFVC
KNCSQMFYTEKGLSSHMCFHSDQWPSPRGKQEPQVFGTEFCKPLRQVLRPEGDRHSPPGT
KKPLDPTAAAPLVVPQSIPVVPVTRHIGSMAMGQEKDGEERDSKESSQQRKRKKRPPPST
AGEPGPAGCHQSRLRSPMFLVDCLLKGLFQCSPYTPPPMLSPIREGSGVYFNTLCSTSTQ
ASPDQLISSMLDQVDGSFGICVVKDDTKISIEPHINIGSRFQAEIPELQERSLAGTDEHV
ASLVWKPWGDMMISSETQDRVTELCNVACSSVMPGGGTNLELALHCLHEAQGNVQVALET
LLLRGPHKPRTHLLADYRYTGSDVWTPIEKRLFKKAFYAHKKDFYLIHKMIQTKTVAQCV
EYYYIWKKMIKFDCGRAPGLEKRVKREPEEVERTEEKVPCSPRERPSHHPTPKLKTKSYR
RESILSSSPNAGSKRTPELLGSAESQGIFPCRECERVFDKIKSRNAHMKRHRLQDHVEPI
IRVKWPVKPFQLKEEELGADIGPLQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0GGX2	0.230	0.228	0.000	1363	0.764	0.754	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
2	AFDB:Q9H0D2	0.999	0.999	0.000	1346	1.000	1.000	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
3	AFDB:Q96PN7	0.123	0.137	3.158E-27	1200	0.207	0.232	Q96PN7.pdb.gz	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
4	AFDB:Q05GC8	0.142	0.154	1.906E-24	1220	0.206	0.227	Q05GC8.pdb.gz	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
5	AFDB:A0A1C7CYX1	0.116	0.142	3.410E-21	1099	0.216	0.265	A0A1C7CYX1.pdb.gz	A0A1C7CYX1_HUMAN Mitotic deacetylase associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=1
6	AFDB:A0A2R8QMX9	0.054	0.050	1.034E-7	1443	0.136	0.127	A0A2R8QMX9.pdb.gz
7	AFDB:F1QAC4	0.061	0.059	1.730E-7	1404	0.146	0.140	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
8	AFDB:J9VT45	0.069	0.122	3.436E-7	738	0.104	0.190	J9VT45.pdb.gz	J9VT45_CRYNH C2H2-type domain-containing protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_03366 PE=4 SV=2
9	AFDB:Q61602	0.047	0.041	4.573E-7	1583	0.148	0.126	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
10	AFDB:F1QPM7	0.058	0.068	5.991E-6	1078	0.130	0.162	F1QPM7.pdb.gz
11	PDB:7aoaD	0.100	0.356	3.030E-5	343	0.030	0.117	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
12	PDB:3w5kB	0.045	0.282	2.051E-2	110	0.022	0.273	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:1oqyA	0.037	0.103	1.801E-1	363	0.026	0.096	1oqyA.pdb.gz
14	PDB:6lthO	0.040	0.128	2.019E-1	325	0.021	0.086	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
15	PDB:7vdvW	0.037	0.184	4.495E-1	248	0.014	0.077	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
16	PDB:5l3cB	0.037	0.345	5.039E-1	134	0.022	0.216	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
17	PDB:7zkwA	0.030	0.113	7.962E-1	243	0.015	0.082	7zkwA.pdb.gz	Structural basis for proton coupled cystine transport by cystinosin.
18	PDB:7pikC	0.038	0.080	8.926E-1	557	0.020	0.048	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
19	PDB:5z56L	0.041	0.131	1.332	342	0.016	0.064	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:6iczL	0.041	0.092	1.332	454	0.019	0.055	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0GGX2	0.0	1947	1363	0.762	0.753	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
2	Q9H0D2	0.0	2742	1346	1.000	1.000	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
3	Q6PJG2	1.10e-70	260	1045	0.122	0.157	MDEAS_HUMAN Mitotic deacetylase-associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=2
4	A0A1C7CYX1	1.43e-70	260	1099	0.129	0.157	A0A1C7CYX1_HUMAN Mitotic deacetylase associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=1
5	Q05GC8	8.86e-65	243	1220	0.091	0.101	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
6	Q96PN7	1.26e-64	243	1200	0.092	0.103	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
7	Q20733	6.14e-23	108	900	0.068	0.102	SAEG1_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=2
8	A8WHS5	1.87e-19	96.7	580	0.044	0.102	A8WHS5_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=1
9	A8WHS4	2.18e-19	96.7	676	0.044	0.087	A8WHS4_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=1
10	Q8N2R0	4.34e-15	80.1	312	0.030	0.128	OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens OX=9606 GN=OSR2 PE=1 SV=2
11	Q91ZD1	4.42e-15	80.1	312	0.030	0.128	OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus OX=10090 GN=Osr2 PE=1 SV=1
12	Q8TAX0	5.81e-15	79.0	266	0.027	0.135	OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens OX=9606 GN=OSR1 PE=2 SV=1
13	Q567J8	6.15e-15	78.2	238	0.027	0.151	OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio OX=7955 GN=osr2 PE=2 SV=1
14	Q66JF8	6.22e-15	78.6	259	0.030	0.154	OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis OX=8364 GN=osr1 PE=2 SV=1
15	B0K011	6.44e-15	78.6	266	0.027	0.135	OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus OX=10116 GN=Osr1 PE=2 SV=1
16	Q9WVG7	6.44e-15	78.6	266	0.027	0.135	OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus OX=10090 GN=Osr1 PE=1 SV=1
17	E1BWE8	6.47e-15	78.6	258	0.027	0.140	E1BWE8_CHICK Odd-skipped related transciption factor 1 OS=Gallus gallus OX=9031 GN=OSR1 PE=4 SV=2
18	P86413	6.84e-15	78.6	259	0.030	0.154	OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis OX=8355 GN=osr1 PE=2 SV=1
19	Q32NK7	7.47e-15	78.6	271	0.027	0.133	OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis OX=8355 GN=osr2-a PE=2 SV=1
20	Q5XJQ7	9.86e-15	78.2	264	0.029	0.148	OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio OX=7955 GN=osr1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01448 ELM2	1.9e-06	39.9	ELM2 domain
2	PF00249 Myb_DNA-binding	5.2	18.7	Myb-like DNA-binding domain
3	PF00096 zf-C2H2	1.8e-10	51.8	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	9.6e-08	43.2	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	0.0032	28.7	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	19	16.9	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	30	16.5	Zinc-finger double domain
8	PF12874 zf-met	1.3e+02	14.3	Zinc-finger of C2H2 type
9	PF17032 zinc_ribbon_15	6.6e+02	12.5	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379047	0.834	Mitochondrial potassium channel located in the mitochondrial inner membrane . Together with ABCB8/MITOSUR, forms a protein complex localized in the mitochondria that mediates ATP- dependent potassium currents across the inner membrane (that is, mitoK(ATP) channel) . May contribute to the homeostatic control of cellular metabolism under stress conditions by regulating the mitochondrial matrix volume .
2	9606.ENSP00000346644	0.815	Ribosomal protein S6 kinase like 1
3	9606.ENSP00000481862	0.797	Rho GTPase-activating protein 23
4	9606.ENSP00000383042	0.757	Lysine-specific histone demethylase 1A
5	9606.ENSP00000361705	0.749	Deoxynucleotidyltransferase terminal-interacting protein 1
6	9606.ENSP00000263563	0.608	Paladin
7	9606.ENSP00000367029	0.568	DNA-directed RNA polymerase I subunit RPA49
8	9606.ENSP00000406046	0.564	DNA polymerase delta catalytic subunit
9	9606.ENSP00000274181	0.545	ADAM metallopeptidase with thrombospondin type 1 motif 16
10	9606.ENSP00000382972	0.534	Small nuclear ribonucleoprotein-associated protein N
11	9606.ENSP00000406012	0.533	Intraflagellar transport protein 140 homolog
12	9606.ENSP00000382610	0.527	Ankyrin repeat domain-containing protein 18A
13	9606.ENSP00000282849	0.519	ADAM metallopeptidase with thrombospondin type 1 motif 18
14	9606.ENSP00000429763	0.506	Protein FAM196A
15	9606.ENSP00000254336	0.505	Uncharacterized protein C19orf57
16	9606.ENSP00000316532	0.504	Transmembrane protein 132E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.607	heterocyclic compound binding
GO:0097159	0.607	organic cyclic compound binding
GO:0003676	0.562	nucleic acid binding
GO:0003682	0.395	chromatin binding
GO:0003677	0.393	DNA binding
GO:0008134	0.357	transcription factor binding
GO:0140297	0.351	DNA-binding transcription factor binding
GO:0140110	0.305	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0019222	0.855	regulation of metabolic process
GO:0060255	0.827	regulation of macromolecule metabolic process
GO:0009987	0.813	cellular process
GO:0051171	0.794	regulation of nitrogen compound metabolic process
GO:0010468	0.745	regulation of gene expression
GO:0051252	0.735	regulation of RNA metabolic process
GO:0009889	0.729	regulation of biosynthetic process
GO:0010556	0.720	regulation of macromolecule biosynthetic process
GO:0006355	0.684	regulation of DNA-templated transcription
GO:0048518	0.359	positive regulation of biological process
GO:0048522	0.336	positive regulation of cellular process
GO:0048519	0.321	negative regulation of biological process
GO:0008152	0.316	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.991	protein-containing complex
GO:1902494	0.915	catalytic complex
GO:0000118	0.755	histone deacetylase complex
GO:0005737	0.667	cytoplasm
GO:0043232	0.463	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]