StarFunc result for job id Q9H0E3

User Input

>input (1048 residues)
MGPPRHPQAGEIEAGGAGGGRRLQVEMSSQQFPRLGAPSTGLSQAPSQIANSGSAGLINP
AATVNDESGRDSEVSAREHMSSSSSLQSREEKQEPVVVRPYPQVQMLSTHHAVASATPVA
VTAPPAHLTPAVPLSFSEGLMKPPPKPTMPSRPIAPAPPSTLSLPPKVPGQVTVTMESSI
PQASAIPVATISGQQGHPSNLHHIMTTNVQMSIIRSNAPGPPLHIGASHLPRGAAAAAVM
SSSKVTTVLRPTSQLPNAATAQPAVQHIIHQPIQSRPPVTTSNAIPPAVVATVSATRAQS
PVITTTAAHATDSALSRPTLSIQHPPSAAISIQRPAQSRDVTTRITLPSHPALGTPKQQL
HTMAQKTIFSTGTPVAAATVAPILATNTIPSATTAGSVSHTQAPTSTIVTMTVPSHSSHA
TAVTTSNIPVAKVVPQQITHTSPRIQPDYPAERSSLIPISGHRASPNPVAMETRSDNRPS
VPVQFQYFLPTYPPSAYPLAAHTYTPITSSVSTIRQYPVSAQAPNSAITAQTGVGVASTV
HLNPMQLMTVDASHARHIQGIQPAPISTQGIQPAPIGTPGIQPAPLGTQGIHSATPINTQ
GLQPAPMGTQQPQPEGKTSAVVLADGATIVANPISNPFSAAPAATTVVQTHSQSASTNAP
AQGSSPRPSILRKKPATDGAKPKSEIHVSMATPVTVSMETVSNQNNDQPTIAVPPTAQQP
PPTIPTMIAAASPPSQPAVALSTIPGAVPITPPITTIAAAPPPSVTVGGSLSSVLGPPVP
EIKVKEEVEPMDIMRPVSAVPPLATNTVSPSLALLANNLSMPTSDLPPGASPRKKPRKQQ
HVISTEEGDMMETNSTDDEKSTAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLL
RHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTN
LEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVL
DHKDRVLKLLNKNGTVKKVSKLKRKEKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8YDB8	0.158	0.157	0.000	1057	0.974	0.966	A0A2R8YDB8.pdb.gz	A0A2R8YDB8_HUMAN Sin3A associated protein 130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1
2	AFDB:Q9H0E3	0.999	0.999	0.000	1048	1.000	1.000	Q9H0E3.pdb.gz	SP130_HUMAN Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1
3	AFDB:A0A2R8QMN6	0.167	0.164	1.206E-60	1069	0.583	0.572	A0A2R8QMN6.pdb.gz
4	AFDB:F1REK0	0.159	0.156	6.624E-59	1072	0.579	0.566	F1REK0.pdb.gz	F1REK0_DANRE Histone deacetylase complex subunit SAP130 OS=Danio rerio OX=7955 GN=zgc:162722 PE=1 SV=1
5	AFDB:Q8IQI0	0.130	0.107	4.079E-10	1294	0.219	0.177	Q8IQI0.pdb.gz	Q8IQI0_DROME Sin3A-associated protein 130, isoform C OS=Drosophila melanogaster OX=7227 GN=Sap130 PE=1 SV=1
6	AFDB:P97837	0.062	0.061	1.511E-1	1059	0.134	0.132	P97837.pdb.gz	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
7	AFDB:Q6ZNL6	0.050	0.039	1.604E-1	1462	0.147	0.105	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
8	AFDB:F4HWC3	0.052	0.047	2.587E-1	1364	0.136	0.105	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
9	AFDB:G5ECF0	0.044	0.032	3.096E-1	1890	0.142	0.079	G5ECF0.pdb.gz	G5ECF0_CAEEL SH2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rin-1 PE=1 SV=1
10	AFDB:Q9QXN0	0.049	0.038	3.704E-1	1986	0.189	0.100	Q9QXN0.pdb.gz	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
11	PDB:6yufA	0.067	0.161	5.943E-1	384	0.011	0.031	6yufA.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.
12	PDB:3ajwA	0.087	0.575	7.111E-1	134	0.010	0.075	3ajwA.pdb.gz
13	PDB:7n6g3I	0.077	0.187	8.507E-1	401	0.011	0.030	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:7nsuD	0.059	0.126	1.018	420	0.016	0.040	7nsuD.pdb.gz
15	PDB:7ungC4	0.069	0.231	1.218	219	0.010	0.046	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:3j6bT	0.049	0.192	1.293	209	0.026	0.129	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:5ew5A	0.063	0.117	1.373	490	0.014	0.031	5ew5A.pdb.gz
18	PDB:2zdiB	0.073	0.642	1.457	106	0.007	0.066	2zdiB.pdb.gz
19	PDB:2jmhA	0.031	0.226	1.642	117	0.017	0.154	2jmhA.pdb.gz
20	PDB:7sqcO1	0.059	0.082	1.642	673	0.009	0.013	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YDB8	0.0	2001	1057	0.975	0.967	A0A2R8YDB8_HUMAN Sin3A associated protein 130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1
2	B0S8H2	0.0	1045	1043	0.600	0.603	B0S8H2_DANRE Histone deacetylase complex subunit SAP130 OS=Danio rerio OX=7955 GN=si:dkey-5i22.5 PE=1 SV=1
3	F1REK0	0.0	1001	1072	0.567	0.554	F1REK0_DANRE Histone deacetylase complex subunit SAP130 OS=Danio rerio OX=7955 GN=zgc:162722 PE=1 SV=1
4	H7BXF5	0.0	1995	1056	0.974	0.967	H7BXF5_HUMAN Sin3A associated protein 130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1
5	Q8BIH0	0.0	1821	1057	0.915	0.907	SP130_MOUSE Histone deacetylase complex subunit SAP130 OS=Mus musculus OX=10090 GN=Sap130 PE=1 SV=2
6	Q9H0E3	0.0	2076	1048	1.000	1.000	SP130_HUMAN Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1
7	Q8IQH9	9.29e-25	114	1257	0.053	0.045	Q8IQH9_DROME Sin3A-associated protein 130, isoform B OS=Drosophila melanogaster OX=7227 GN=Sap130 PE=1 SV=1
8	Q9XZ09	9.67e-25	114	1219	0.053	0.046	Q9XZ09_DROME Sin3A-associated protein 130, isoform A OS=Drosophila melanogaster OX=7227 GN=Sap130 PE=1 SV=1
9	Q8IQI0	9.71e-25	114	1294	0.053	0.043	Q8IQI0_DROME Sin3A-associated protein 130, isoform C OS=Drosophila melanogaster OX=7227 GN=Sap130 PE=1 SV=1
10	M9PI47	9.86e-25	114	1209	0.053	0.046	M9PI47_DROME Sin3A-associated protein 130, isoform F OS=Drosophila melanogaster OX=7227 GN=Sap130 PE=1 SV=1
11	M9PCC4	9.95e-25	114	1210	0.053	0.046	M9PCC4_DROME Sin3A-associated protein 130, isoform G OS=Drosophila melanogaster OX=7227 GN=Sap130 PE=1 SV=1
12	M9PC48	0.001	45.4	18095	0.146	0.008	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PCJ6	0.001	45.4	18641	0.146	0.008	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	Q62170	0.25	37.4	397	0.029	0.076	SELPL_MOUSE P-selectin glycoprotein ligand 1 OS=Mus musculus OX=10090 GN=Selplg PE=1 SV=2
15	G5EBN5	0.90	36.2	1492	0.039	0.027	G5EBN5_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
16	H8ESG1	0.93	36.2	1494	0.039	0.027	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06144 DNA_pol3_delta	2.6e+02	12.8	DNA polymerase III, delta subunit
2	PF16014 SAP130_C	7.3e-193	652.8	Histone deacetylase complex subunit SAP130 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000021301

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000060659	0.804	Histone deacetylase
2	9598.ENSPTRP00000028485	0.756	Sin3A-associated protein, 30kDa
3	9598.ENSPTRP00000003598	0.740	AT rich interactive domain 4B (RBP1-like)
4	9598.ENSPTRP00000009363	0.730	Uncharacterized protein
5	9598.ENSPTRP00000046774	0.719	SIN3 homolog A, transcription regulator
6	9598.ENSPTRP00000012490	0.704	Uncharacterized protein
7	9598.ENSPTRP00000045942	0.697	AT rich interactive domain 4A (RBP1-like)
8	9598.ENSPTRP00000029802	0.686	SAP30-like
9	9598.ENSPTRP00000049696	0.646	Histone deacetylase
10	9598.ENSPTRP00000028526	0.607	Inhibitor of growth family, member 2
11	9598.ENSPTRP00000009706	0.583	Sin3A-associated protein, 18kDa
12	9598.ENSPTRP00000025171	0.572	Uncharacterized protein
13	9598.ENSPTRP00000020297	0.569	Uncharacterized protein
14	9598.ENSPTRP00000030396	0.560	Belongs to the histone H2A family.
15	9598.ENSPTRP00000028020	0.554	Belongs to the histone H2A family.
16	9598.ENSPTRP00000032725	0.554	Belongs to the histone H2A family.
17	9598.ENSPTRP00000008065	0.549	Belongs to the histone H2A family.
18	9598.ENSPTRP00000030444	0.549	Belongs to the histone H2A family.
19	9598.ENSPTRP00000030446	0.549	Belongs to the histone H2A family.
20	9598.ENSPTRP00000060497	0.549	Belongs to the histone H2A family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.967	regulation of cellular process
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0048519	0.949	negative regulation of biological process
GO:0048523	0.926	negative regulation of cellular process
GO:0031324	0.916	negative regulation of cellular metabolic process
GO:0051172	0.915	negative regulation of nitrogen compound metabolic process
GO:0045934	0.912	negative regulation of nucleobase-containing compound metabolic process
GO:0006357	0.895	regulation of transcription by RNA polymerase II
GO:0051253	0.886	negative regulation of RNA metabolic process
GO:0045892	0.788	negative regulation of DNA-templated transcription
GO:0000122	0.644	negative regulation of transcription by RNA polymerase II
GO:0071704	0.418	organic substance metabolic process
GO:0044238	0.366	primary metabolic process
GO:0006807	0.360	nitrogen compound metabolic process
GO:0043170	0.352	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	0.999	nuclear speck
GO:0032991	0.551	protein-containing complex
GO:0043232	0.523	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]