StarFunc result for job id Q9H0E9

User Input

>input (1235 residues)
MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRAIKPFAEPGRPPDWFS
QKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYR
RLKRDAELIQAGHMDSRLDELCNDIATKKKLEEEEAEVKRKATDAAYQARQAVKTPPRRL
PTVMVRSPIDSASPGGDYPLGDLTPTTMEEATSGVNESEMAVASGHLNSTGVLLEVGGVL
PMIHGGEIQQTPNTVAASPAASGAPTLSRLLEAGPTQFTTPLASFTTVASEPPVKLVPPP
VESVSQATIVMMPALPAPSSAPAVSTTESVAPVSQPDNCVPMEAVGDPHTVTVSMDSSEI
SMIINSIKEECFRSGVAEAPVGSKAPSIDGKEELDLAEKMDIAVSYTGEELDFETVGDII
AIIEDKVDDHPEVLDVAAVEAALSFCEENDDPQSLPGPWEHPIQQERDKPVPLPAPEMTV
KQERLDFEETENKGIHELVDIREPSAEIKVEPAEPEPVISGAEIVAGVVPATSMEPPELR
SQDLDEELGSTAAGEIVEADVAIGKGDETPLTNVKTEASPESMLSPSHGSNPIEDPLEAE
TQHKFEMSDSLKEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEPKEEDQGEGYLSEMDN
EPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVW
RAAANHRYANVFLQPVTDDIAPGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMF
QNAVMYNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQTSESGISAKSLRGRDSTRKQD
ASEKDSVPMGSPAFLLSLFMGHEWVWLDSEQDHPNDSELSNDCRSLFSSWDSSLDLDVGN
WRETEDPEAEELEESSPEREPSELLVGDGGSEESQEAARKASHQNLLHFLSEVAYLMEPL
CISSNESSEGCCPPSGTRQEGREIKASEGERELCRETEELSAKGDPLVAEKPLGENGKPE
VASAPSVICTVQGLLTESEEGEAQQESKGEDQGEVYVSEMEDQPPSGECDDAFNIKETPL
VDTLFSHATSSKLTDLSQDDPVQDHLLFKKTLLPVWKMIASHRFSSPFLKPVSERQAPGY
KDVVKRPMDLTSLKRNLSKGRIRTMAQFLRDLMLMFQNAVMYNDSDHHVYHMAVEMRQEV
LEQIQVLNIWLDKRKGSSSLEGEPANPVDDGKPVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0E9	1.000	1.000	0.000	1235	1.000	1.000	Q9H0E9.pdb.gz	BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=2
2	AFDB:A0A0G2JWN9	0.215	0.268	2.467E-79	951	0.658	0.855	A0A0G2JWN9.pdb.gz	A0A0G2JWN9_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=2
3	AFDB:H7C127	0.236	0.309	1.025E-76	892	0.650	0.900	H7C127.pdb.gz	H7C127_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
4	AFDB:H7C179	0.235	0.319	1.770E-75	861	0.602	0.863	H7C179.pdb.gz	H7C179_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
5	AFDB:Q5TLG7	0.158	0.199	6.229E-74	957	0.629	0.812	Q5TLG7.pdb.gz	Q5TLG7_RAT Nuclear receptor coactivator p120 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=2 SV=1
6	AFDB:Q803V1	0.195	0.260	8.703E-42	863	0.343	0.491	Q803V1.pdb.gz
7	AFDB:Q8T9B8	0.121	0.163	1.369E-16	874	0.167	0.236	Q8T9B8.pdb.gz	Q8T9B8_DROME SD08060p OS=Drosophila melanogaster OX=7227 GN=Brd8 PE=2 SV=1
8	AFDB:Q6P9L3	0.092	0.102	4.595E-7	1114	0.128	0.142	Q6P9L3.pdb.gz	Q6P9L3_MOUSE Bptf protein OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
9	AFDB:O00268	0.054	0.061	7.216E-4	1085	0.122	0.139	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
10	AFDB:Q9SZQ2	0.036	0.036	1.006E-3	1211	0.140	0.143	Q9SZQ2.pdb.gz	Q9SZQ2_ARATH AT4g29790/F27B13_30 OS=Arabidopsis thaliana OX=3702 GN=At4g29790 PE=1 SV=1
11	PDB:6v8oO	0.068	0.195	1.639	384	0.023	0.076	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
12	PDB:6k15H	0.038	0.105	2.179	393	0.022	0.069	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
13	PDB:7egb0	0.041	0.143	2.285	234	0.015	0.077	7egb0.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:7mjpA	0.065	0.176	3.341	366	0.019	0.063	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
15	PDB:4hnjB	0.038	0.263	4.442	130	0.010	0.092	4hnjB.pdb.gz	PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis.
16	PDB:2ilkA	0.036	0.165	4.657	155	0.018	0.142	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
17	PDB:6tljS	0.043	0.113	4.657	293	0.013	0.055	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
18	PDB:7naod	0.051	0.201	4.657	217	0.019	0.111	7naod.pdb.gz
19	PDB:3euhB	0.045	0.141	5.632	321	0.016	0.062	3euhB.pdb.gz
20	PDB:7acjy	0.044	0.394	5.905	86	0.015	0.209	7acjy.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JWN9	0.0	1140	927	0.490	0.653	A0A0G2JWN9_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=2
2	A0A8I5XUT9	0.0	1467	926	0.627	0.836	A0A8I5XUT9_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=1
3	A0A8I5Y6W9	0.0	1142	899	0.490	0.673	A0A8I5Y6W9_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=1
4	A0A8I6AR97	0.0	1376	881	0.599	0.840	A0A8I6AR97_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=1
5	A0A8I6ATL0	0.0	1140	999	0.490	0.606	A0A8I6ATL0_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=1
6	B5MCW3	0.0	1744	878	0.696	0.979	B5MCW3_HUMAN Bromodomain containing 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
7	E9PTN1	0.0	1113	936	0.474	0.626	E9PTN1_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=2
8	F1M858	0.0	1654	1133	0.725	0.790	F1M858_RAT Bromodomain containing 8 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=1 SV=4
9	H7C127	0.0	1484	892	0.635	0.879	H7C127_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
10	H7C128	0.0	1410	857	0.605	0.872	H7C128_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
11	H7C179	0.0	1427	861	0.609	0.873	H7C179_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
12	Q5TLG7	0.0	1145	957	0.491	0.633	Q5TLG7_RAT Nuclear receptor coactivator p120 OS=Rattus norvegicus OX=10116 GN=Brd8 PE=2 SV=1
13	Q9H0E9	0.0	2524	1235	1.000	1.000	BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=2
14	H0YA84	9.72e-96	306	195	0.121	0.769	H0YA84_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
15	Q6PFM2	6.03e-76	271	818	0.175	0.264	Q6PFM2_DANRE Bromodomain containing 8 OS=Danio rerio OX=7955 GN=brd8 PE=2 SV=1
16	O74350	7.85e-13	73.2	299	0.024	0.100	BDC1_SCHPO Bromodomain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bdc1 PE=1 SV=1
17	A8CYR7	1.46e-12	71.6	276	0.034	0.152	A8CYR7_DANRE Bromodomain-containing protein 2 OS=Danio rerio OX=7955 GN=brd2b PE=2 SV=1
18	Q2XY62	1.81e-12	74.3	861	0.034	0.049	Q2XY62_DROME CG14514 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Brd8 PE=4 SV=1
19	A8CYR1	1.89e-12	74.3	836	0.037	0.055	A8CYR1_DANRE Bromodomain-containing 2a OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1
20	Q1LWX7	1.93e-12	74.3	832	0.037	0.055	Q1LWX7_DANRE Bromodomain-containing 2 OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	2e-39	144.9	Bromodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254900

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374213	0.997	E1A-binding protein p400
2	9606.ENSP00000340330	0.996	Histone acetyltransferase KAT5
3	9606.ENSP00000247843	0.995	YEATS domain-containing protein 4
4	9606.ENSP00000331310	0.993	Mortality factor 4-like protein 1
5	9606.ENSP00000361363	0.993	DNA methyltransferase 1-associated protein 1
6	9606.ENSP00000352925	0.992	Transformation/transcription domain-associated protein
7	9606.ENSP00000359518	0.992	MRG/MORF4L-binding protein
8	9606.ENSP00000320566	0.990	Inhibitor of growth protein 3
9	9606.ENSP00000473172	0.990	RuvB-like 2
10	9606.ENSP00000394417	0.988	Mortality factor 4-like protein 2
11	9606.ENSP00000362166	0.986	Chromatin modification-related protein MEAF6
12	9606.ENSP00000318297	0.982	RuvB-like 1
13	9606.ENSP00000397552	0.979	Actin-like protein 6A
14	9606.ENSP00000463154	0.950	Acidic leucine-rich nuclear phosphoprotein 32 family member E
15	9606.ENSP00000263062	0.946	Enhancer of polycomb homolog 1
16	9606.ENSP00000406037	0.944	Histone acetyltransferase KAT8
17	9606.ENSP00000346464	0.942	Vacuolar protein sorting-associated protein 72 homolog
18	9606.ENSP00000332194	0.938	Histone H2A type 2-C
19	9606.ENSP00000328484	0.926	Histone H2A type 1-J
20	9606.ENSP00000355205	0.924	DNA helicase INO80

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030374	0.999	nuclear receptor coactivator activity
GO:0046966	0.999	nuclear thyroid hormone receptor binding
GO:0003824	0.653	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0010468	0.988	regulation of gene expression
GO:0010604	0.987	positive regulation of macromolecule metabolic process
GO:0051252	0.986	regulation of RNA metabolic process
GO:0051173	0.985	positive regulation of nitrogen compound metabolic process
GO:0031325	0.985	positive regulation of cellular metabolic process
GO:0045944	0.978	positive regulation of transcription by RNA polymerase II
GO:0009987	0.482	cellular process
GO:0071704	0.472	organic substance metabolic process
GO:0044238	0.463	primary metabolic process
GO:0006807	0.458	nitrogen compound metabolic process
GO:0043170	0.455	macromolecule metabolic process
GO:0019538	0.300	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005739	0.996	mitochondrion
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0000785	0.879	chromatin
GO:0032991	0.867	protein-containing complex
GO:1902494	0.681	catalytic complex
GO:0000812	0.385	Swr1 complex
GO:0035267	0.375	NuA4 histone acetyltransferase complex
GO:0000786	0.333	nucleosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]